CAZyme Information: MGYG000000577_00716

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; UMGS1502
• CAZyme ID: MGYG000000577_00716
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558	MGYG000000577_4|CGC1	62537.25	5.2921

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000577	1390065	MAG	Madagascar	Africa

• Gene Location: Start: 21163; End: 22839 Strand: +

Full Sequence      

MGRLLFRISDESSLSALTPRQRKLVEGAMTYNALLQPGRALEYKIYLGGEWKYPCLTDVT
TLDGSLTAKAGIDPVCEFSAVSLVESQSEFSPHYYFDDIPVIDSGVRHIALTSDDDVDDD
LMFDRGYTFAEKLYRDLEIRNPLLLDDVREFNRRRRIAEGKEAIKPSGLPLYEGAVKVSN
RPVASIAPGQSVVDAPKAVIVAMHWLQAGGAERWAMETIRLVRESGMTPIVITSINSHQP
WITSADLEGSVVMNLTFPTQDRPGDEPLLRALFEQFDVRGVLIHHSRWMYDRLWWVKRYF
PYVPVVDSLHIVEYRCHGGYPAESVSHDGYIDLHHVISPQLVNWMTEVHGVNPEKVVDAP
LVDLTADLSSLSCKGRVSKDALTLAFVGRISRQKRPDAFIYLAKSLEKKYPGRFRFIMHG
SGDIDAVVDRMIDHYGLSGVVDRRSIDVPVSKTYEDADILVISSVNEGITLTTFEAVSSG
VPVLSTDVGSQKTVIPAEALLGSSTRSFQKKAMDLAVKMDEDEGFRQAIWGSEKKLIEDF
SQLETADSLFTRMINEWK

Enzyme Prediction     

No EC number prediction in MGYG000000577_00716.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	380	498	2.7e-19	0.74375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03819	GT4_WavL-like	1.42e-27	204	499	6	298	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.
cd03801	GT4_PimA-like	2.53e-19	209	498	14	309	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.96e-16	198	549	4	370	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03808	GT4_CapM-like	4.81e-14	378	496	186	304	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03807	GT4_WbnK-like	2.46e-13	206	489	9	297	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOL34938.1	8.54e-202	6	557	5	560
QRI57275.1	2.69e-198	14	557	15	561
QUI46450.1	2.69e-198	14	557	15	561
QUI45533.1	2.69e-198	14	557	15	561
QRI58947.1	9.76e-196	6	557	5	560

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C7QKE8	6.63e-06	282	495	111	350	D-inositol 3-phosphate glycosyltransferase 2 OS=Catenulispora acidiphila (strain DSM 44928 / JCM 14897 / NBRC 102108 / NRRL B-24433 / ID139908) OX=479433 GN=mshA2 PE=3 SV=1
C6WPK3	8.59e-06	345	549	181	400	D-inositol 3-phosphate glycosyltransferase OS=Actinosynnema mirum (strain ATCC 29888 / DSM 43827 / JCM 3225 / NBRC 14064 / NCIMB 13271 / NRRL B-12336 / IMRU 3971 / 101) OX=446462 GN=mshA PE=3 SV=1
A6W6D9	8.91e-06	345	495	187	353	D-inositol 3-phosphate glycosyltransferase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) OX=266940 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000577_00716.