CAZyme Information: MGYG000000579_00314

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000000579_00314
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	MGYG000000579_2|CGC1	54842.79	4.8468

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000579	2259318	MAG	Madagascar	Africa

• Gene Location: Start: 191829; End: 193262 Strand: +

Full Sequence      

MGVFPKDFLWGGATAANQFEGAWDVDGKGPSCMDMATNGNHHHPREITPELDPSKLYPCH
DGVDFYHHYKEDIALLAEMGFRVFRFSINWPRIFPTGFESEPNEAGLAFYDRVMDECRKY
GIEPLVTLSHYEMPFAMCQKIDGWASREAIDCYVKYAKTVMEHFRGKCRYWLTFNEINCG
MMSLGNYMSLGILNPGSFDLRHQKDDPQRRLQALHHQFVASALAVKAGHEIDPDNKMGCM
IAYMLAYPLTPNPADVELARERNQYRNYYCSDVQVRGEYPYFAQRIWDEEGVTLDITDED
RKILKEGTVDFYTHSYYQSQCASTDPAEETSGNLLGGAKNPYLKETAWEWPIDPMGLRIM
LNQVYERYQIPIMVVENGLGCRDEVNPDGSIDDDYRIDYLRDHIKAVAEAIKDGVEIWGY
TPWGCIDLVSNADGEMAKRYGFVYVDKHDDGTGTMERSRKKSFYWYKKVIETNGEGL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	474	9e-152	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	477	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	477	1	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	4	477	6	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	476	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	3	477	5	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN32466.1	2.04e-238	1	477	1	478
QOT69922.1	6.29e-238	3	477	5	480
QIH42235.1	6.76e-238	3	477	7	482
ANQ23641.1	2.80e-234	3	477	5	480
ALR17800.1	5.65e-234	3	477	5	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.05e-189	4	477	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	1.15e-176	3	477	7	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4IPL_A	2.15e-171	1	477	17	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	5.50e-165	1	477	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.57e-164	1	477	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46130	3.61e-176	4	477	7	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	4.46e-176	4	477	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46829	6.30e-176	3	477	7	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P24240	3.50e-169	1	477	1	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P42973	4.44e-166	1	477	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000579_00314.