CAZyme Information: MGYG000000579_00526

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000000579_00526
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200	MGYG000000579_4|CGC2	21896.61	4.8115

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000579	2259318	MAG	Madagascar	Africa

• Gene Location: Start: 61752; End: 62354 Strand: +

Full Sequence      

MIEEQVFEVSTERAGAYRSISEALAAVDQLYPNAEQPVRIHVDPGEYRERVEIHRPHVTL
VGETADSVRIVGGLGAKMPSSDGSGVDGTLGTFRTYTVLVDADDVRLENLTIVNDAGDGR
EVGQAIALYADGDRLVVDACYITGHQDTLFLGPLPPREVKPGGFIGPKQFAPRRVGRQYF
RRCRIEGDVDFIFGGARAFF

Enzyme Prediction     

No EC number prediction in MGYG000000579_00526.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	9	200	5.8e-47	0.5486111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	5.48e-38	25	200	99	278	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.16e-28	15	200	10	160	Pectinesterase.
PRK10531	PRK10531	6.94e-27	17	200	94	295	putative acyl-CoA thioester hydrolase.
PLN02990	PLN02990	1.05e-25	9	197	263	417	Probable pectinesterase/pectinesterase inhibitor
PLN02773	PLN02773	4.65e-25	1	198	1	173	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34433.1	4.87e-113	9	200	10	201
ATP54718.1	3.38e-108	4	200	5	201
QUC03567.1	1.45e-69	1	200	1	196
QIX89293.1	3.94e-59	9	200	19	203
ANU50094.1	6.24e-58	9	200	19	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	5.57e-15	15	200	17	171	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.06e-14	15	200	17	171	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	3.66e-14	6	200	7	185	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	4.05e-14	10	194	37	206	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1XG2_A	1.11e-13	9	200	7	163	ChainA, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	5.65e-21	9	197	260	414	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9FJ21	6.72e-18	9	194	262	413	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
O23447	7.13e-18	9	200	394	551	Putative pectinesterase/pectinesterase inhibitor 43 OS=Arabidopsis thaliana OX=3702 GN=PME43 PE=2 SV=1
O49298	7.73e-17	9	198	253	409	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q43043	9.19e-17	9	198	61	215	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000579_00526.