CAZyme Information: MGYG000000580_01193

Basic Information

• Species: Streptococcus vestibularis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus vestibularis
• CAZyme ID: MGYG000000580_01193
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223	MGYG000000580_6|CGC2	23038.57	5.9165

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000580	1956603	MAG	Madagascar	Africa

• Gene Location: Start: 119998; End: 120669 Strand: -

Full Sequence      

MFKKSYKGRRIKLAVKKSLAVPVVIVTSFIVILAVSLSTIVNKGLVNAFSDSVTPTPSTT
STTADLVKSTEVSSSKENKEKIGESKRQSETTTEIVGAAEQPQSESATTASIDATFTQNN
GAVFSVAASTAGNGSVILSNGNTAGEIGSYAAAQMAAATGVPQSTWESIIARESNGDHTV
ANSSGASGLFQTMPGWGSTATVEDQIQSALNAYNTQGLSAWNY

Enzyme Prediction     

No EC number prediction in MGYG000000580_01193.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13925	RPF	8.55e-10	164	221	1	68	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
pfam06737	Transglycosylas	1.50e-04	162	221	1	72	Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.
cd00254	LT-like	8.78e-04	168	198	6	36	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATH75448.1	9.07e-116	1	223	1	227
CAD0166394.1	9.07e-116	1	223	1	227
QHD71358.1	9.07e-116	1	223	1	227
CAD0166110.1	9.07e-116	1	223	1	227
QKM73636.1	9.07e-116	1	223	1	227

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8CMZ9	2.09e-32	135	221	147	233	Probable transglycosylase IsaA OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=isaA PE=3 SV=1
Q5HL49	2.09e-32	135	221	147	233	Probable transglycosylase IsaA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=isaA PE=3 SV=1
Q6GDN1	1.08e-27	135	223	145	233	Probable transglycosylase IsaA OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=isaA PE=3 SV=1
Q2YWD9	4.21e-27	135	223	145	233	Probable transglycosylase IsaA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=isaA PE=3 SV=1
Q6G6A5	1.63e-26	135	223	145	233	Probable transglycosylase IsaA OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=isaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.993708	0.005677	0.000035	0.000039	0.000017	0.000524

TMHMM  Annotations     

start	end
19	41