CAZyme Information: MGYG000000581_00412

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495
• CAZyme ID: MGYG000000581_00412
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392		43895.22	9.5933

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000581	1426046	MAG	Madagascar	Africa

• Gene Location: Start: 23510; End: 24688 Strand: -

Full Sequence      

MIIAEQPLKVYLIAGEPSGDLLGSRLMRALRRKTAGNVAFFGLGGDTMEAEGLKPLFDIS
DLAIMGLIEVIPSIPKVLRHIKETVADILRVQPDIVITIDSWSFSARVHQKLRQLKTGIP
QLHYVAPQVWAWKKKRAKTMYKYIDALMTLLPQEPKYFTPYHLETVFVGHPVIESEVLQA
DGNEFRRQYQIPDNKKIITILPGSRHNEVGRLLPVFAEAARQLLAQNPNFYFVIPTVRTV
ASHVKAEAAKLNLPLLVVESQQDRYNAFRASSAAIAASGTVALELAICHIPHIIGYKVSP
LTAFIAGKFLKIQFVNLSNIMLGREVVPELLQEQCIAGNIVRYINELLSHGELYQRQMDG
FDKVKALLSNGEQTPSDNAADFILDLISRTRR

Enzyme Prediction     

No EC number prediction in MGYG000000581_00412.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	10	368	5.8e-119	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	8.28e-138	7	389	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	1.19e-134	7	392	1	380	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	1.56e-101	10	368	1	359	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.75e-75	12	386	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	4.03e-49	11	331	230	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10250.1	3.89e-180	8	389	5	386
ARJ65449.1	2.02e-115	7	391	5	390
CUW40282.1	7.48e-113	8	391	6	390
AMW35095.1	6.24e-111	11	385	9	383
BAE51288.1	1.17e-110	10	387	3	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	9.76e-59	5	386	4	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	9.76e-59	5	386	4	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W4D7	2.34e-111	10	387	3	381	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
B6IST7	1.39e-107	6	389	2	385	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
Q5FUA3	1.36e-91	10	388	31	406	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
Q0BS63	1.41e-82	10	350	6	343	Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=lpxB PE=3 SV=1
Q3SRI5	4.32e-82	9	391	12	393	Lipid-A-disaccharide synthase OS=Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255) OX=323098 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000581_00412.