CAZyme Information: MGYG000000581_01094

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495
• CAZyme ID: MGYG000000581_01094
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541		60210.68	9.8098

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000581	1426046	MAG	Madagascar	Africa

• Gene Location: Start: 27256; End: 28881 Strand: +

Full Sequence      

MRTRQPSTTIIAANGNEIKSFGTVYSEVIRSEELPQYVVDAITATEDRRFYSHFGFDIIS
FSRAMIANLFAGRYAQGGSTITQQVAKNLFLTNQKNIKRKTQELLLAFWLEHKFSKEQIL
TLYLNRVYLGSGTYGIEAASQKYFQKSSRDLNMLEAAVIAGMLKAPSRYNPIASQKRALD
RAAVVLKNMADNGYISKAEKAAAVKMKLGTEKSMKVENANYFADWVYNEVNDYIGERDND
IYVMTTLDQNLQEKAAQILSRTITANKAKNVTQGAIVVLDYQGAVKVMVGGINYNRSQFN
RATQALRQPGSAFKPFVYLTALQKGYTREDKIADVPLTIGNWKPENADKKYYGEVSLEYA
LIKSLNLATINLAQQLKGSDIIRNAKKMGISTPIKNTPSLPLGTFEVKVIDMAASYAAIA
NGGYAVWPHSIEEIYTKDGFQLYQREPDNEIRILDKNNVAELTKMLVNVINYGTGRKAQI
AGFAAGKTGTSQGNRDAWFVGFNNRYVAAVWLGNDDDSPMKGVSGANLPAEIWQKTMALT
E

Enzyme Prediction     

No EC number prediction in MGYG000000581_01094.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	15	189	1.5e-66	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	0.0	32	538	8	526	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	0.0	4	537	52	593	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	2.36e-159	8	538	49	716	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	1.19e-124	29	538	150	680	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK09506	mrcB	1.40e-97	35	526	220	735	bifunctional glycosyl transferase/transpeptidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR98160.1	1.23e-242	2	541	77	615
CCQ72024.1	2.60e-168	4	537	31	567
QQP92621.1	3.95e-168	4	537	96	631
QEX20106.1	7.94e-167	5	538	70	605
QEX14746.1	3.08e-166	5	538	70	605

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OON_A	3.99e-83	10	537	23	719	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3UDF_A	7.37e-77	10	520	23	694	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
5FGZ_A	5.29e-74	35	538	165	691	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	7.57e-74	35	538	186	712	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3FWL_A	1.52e-69	35	538	169	695	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66874	8.63e-100	7	533	44	660	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
O87626	1.41e-95	9	533	51	697	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
P0A0Z5	4.07e-94	9	533	51	698	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
P0A0Z6	4.07e-94	9	533	51	698	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1
Q5FAC7	5.97e-93	9	533	51	698	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999609	0.000388	0.000017	0.000002	0.000001	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000581_01094.