CAZyme Information: MGYG000000582_00429

Basic Information

• Species: Lactococcus garvieae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus garvieae
• CAZyme ID: MGYG000000582_00429
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291	MGYG000000582_3|CGC1	33763.59	5.2892

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000582	2064828	MAG	Madagascar	Africa

• Gene Location: Start: 92508; End: 93383 Strand: -

Full Sequence      

MITMNITISLVAYAQKFTETESFESLLRMSDIIKNKLNIIVFDNGSTDYSDVALPSGFHS
LTYIYNKDDVERGTRIAYETSLTHSNDEWLMLLDDDTSLTEDYLTLLFAELESKDRDREI
VAYCAEIYDGRTQISPTASETLDMLLFPKEAGVYEKDISGISSTLTLRKAFIEDVGGFSK
EFPLDYLDHWLFSQIIFKQKKVEVLNCQLSHQLSVQDLSSLSEERFYSIFSSEYKFYKAY
KPELFCQLNKKYVKMVLKGFLRRDSGIRWKSLIKVMLRRKTNKPEGKRGLE

Enzyme Prediction     

No EC number prediction in MGYG000000582_00429.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	8.26e-12	2	188	1	195	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd02526	GT2_RfbF_like	1.49e-11	39	214	27	206	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
pfam00535	Glycos_transf_2	3.93e-07	21	171	15	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	8.09e-06	21	202	14	154	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam13506	Glyco_transf_21	7.66e-04	88	178	33	120	Glycosyl transferase family 21. This is a family of ceramide beta-glucosyltransferases - EC:2.4.1.80.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSQ98357.1	3.83e-195	4	291	1	288
QSR12510.1	6.08e-192	4	291	1	288
QSR02204.1	6.08e-192	4	291	1	288
QSR11758.1	2.89e-190	4	291	1	288
BAV02595.1	1.07e-143	4	279	1	276

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000582_00429.