CAZyme Information: MGYG000000582_00843

Basic Information

• Species: Lactococcus garvieae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus garvieae
• CAZyme ID: MGYG000000582_00843
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	MGYG000000582_6|CGC2	41768.38	5.254

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000582	2064828	MAG	Madagascar	Africa

• Gene Location: Start: 55123; End: 56268 Strand: +

Full Sequence      

MENIVDYSNRVKGKKVGAGQCGDLMKDWFITETGRQQLANDLDEWGYFPGTDAYTSWNVA
TQTNWAAVGFDVINTPSFSQLRAGDIFFISTSKVPGSGHTGIVVSTAGNNVTTLEQNILN
AQYAQLLPGENSWSWYGFDKIVRPKGGAPSPGDGGKATSTGTNGLNLIKQFEGCRLTAYD
IGDGKITIGWGHAENKGNTNLVAGVTTWTQAQADKQLVTDLKVYENAINSYFTRTFNQNQ
FDAMASFTYNLGAGIFAQDGWEKNASNSYITASFPNYINKGSAFEEGLKKRRQAEVNLFN
TPVSGGSETDEGEIEMILYKVNDKNSKMNGSIWMFNGEQLTRLDGVSAAKFAKNFKTTDV
NQAEMSSFKNIGFRTVGEFKY

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	162	295	3.2e-31	0.9781021897810219

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	3.59e-43	164	300	1	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	1.44e-26	155	304	2	152	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16901	lyz_P1	2.68e-24	159	298	1	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd16900	endolysin_R21-like	4.10e-13	167	257	11	96	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam00959	Phage_lysozyme	1.54e-09	187	293	3	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSR00514.1	1.49e-233	1	325	1	325
BAK57808.1	3.02e-139	119	325	1	207
BAK59755.1	3.02e-139	119	325	1	207
VTT48601.1	9.67e-71	150	317	132	303
ASE65333.1	9.67e-71	150	317	132	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	4.20e-17	154	299	48	193	ChainA, Lysozyme [Acinetobacter baumannii]
6H9D_A	1.67e-12	164	302	10	149	ChainA, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]
2ANV_A	1.01e-11	162	257	6	100	ChainA, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]
7M5I_A	6.37e-11	164	299	13	153	ChainA, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P62692	2.53e-33	163	327	6	167	Endolysin OS=Lactococcus phage c2 OX=31537 GN=L3 PE=3 SV=1
P62693	2.53e-33	163	327	6	167	Endolysin OS=Lactococcus phage phivML3 OX=10746 GN=L3 PE=3 SV=1
P07540	2.85e-14	164	301	7	144	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
P11187	3.87e-14	164	301	7	144	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
Q9T1T5	1.59e-11	164	301	7	145	Endolysin OS=Acyrthosiphon pisum secondary endosymbiont phage 1 OX=2682836 GN=13 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.993505	0.006190	0.000179	0.000044	0.000016	0.000075

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000582_00843.