CAZyme Information: MGYG000000582_00877

Basic Information

• Species: Lactococcus garvieae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus garvieae
• CAZyme ID: MGYG000000582_00877
• CAZy Family: GH73
• CAZyme Description: Autolysin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310		32321.67	4.2597

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000582	2064828	MAG	Madagascar	Africa

• Gene Location: Start: 92561; End: 93493 Strand: +

Full Sequence      

MNTKHKFLFGAAAVALTSLGAVKAQAMSVQELAEAATPVANEYGLYPSVMIAQGILESSA
GQSALAVNYNNIFGVKYTSGNPVYLPTQEFLDGQMHNVVEPFQAYASVAEACAAQARLLR
GSFLYSGVWRENTSSYQDATAWLQGRYATDPNYASKLNAVIAQYGLTAYDGGGEVATTST
TSYVTATTSTDTSSYGTQAYTVQEGDTVYDIAAHYGVSMDALLSQNGLSATDHIMQGQVL
QIPTAGTSATTTTSTTSASTIATSAVSSSYTVQSGDTLTSIASVYGRTADELAAMNGITG
NIYPGQTLSV

Enzyme Prediction     

No EC number prediction in MGYG000000582_00877.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	33	166	1.2e-30	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.28e-56	6	174	12	192	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK06347	PRK06347	2.11e-42	29	310	154	449	1,4-beta-N-acetylmuramoylhydrolase.
PRK08581	PRK08581	2.25e-32	29	170	324	472	amidase domain-containing protein.
smart00047	LYZ2	5.22e-26	19	169	2	144	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	9.78e-19	33	166	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSQ98554.1	5.18e-201	1	310	1	310
QSR00544.1	7.04e-199	1	310	1	310
BAK57843.1	7.04e-199	1	310	1	310
BAK59790.1	7.04e-199	1	310	1	310
QSR02407.1	1.94e-198	1	310	1	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	3.10e-30	29	170	34	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	2.66e-22	29	170	64	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	2.81e-10	41	163	19	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	3.67e-10	41	163	19	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	1.99e-51	11	310	166	472	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	3.13e-41	17	310	54	379	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q9CIT4	7.18e-39	29	310	66	364	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	1.35e-38	29	310	66	362	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	7.03e-38	29	310	66	362	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000276	0.998929	0.000245	0.000198	0.000179	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000582_00877.