CAZyme Information: MGYG000000583_00284

Basic Information

• Species: Acetatifactor sp900766575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900766575
• CAZyme ID: MGYG000000583_00284
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	MGYG000000583_3|CGC2	36353.91	4.6584

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000583	2865631	MAG	Madagascar	Africa

• Gene Location: Start: 87236; End: 88177 Strand: -

Full Sequence      

MPTADPKATKEARELLQYLHTVAGKQIITGQHTQTIPCEEITYIRENTGKEPKLRGFELL
AYSPNINYEDASPECLKEVEENKGTVETALQWARENRSAGILTFSFHWFSPIGGRDKSFY
AEHTDFDATKVLQEGTPERTAFYHDMDVIAEILQRFQEENIPILWRPFHESYGTWFWWGA
KGAEVARDLYRLMFDYYTGVKNLHNLLWVWNCDIPEAYPGDTYVDVVSLDVYLPEYQATD
YADTYEKLVQATSREKVAALAEIGYLPDVDLLQKSRIPWAYYMTWSKEFCIGEQYNSVKN
LKKMYGSEYTVTL

Enzyme Prediction     

No EC number prediction in MGYG000000583_00284.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	5	313	1.2e-94	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	7.54e-54	5	312	2	308	Glycosyl hydrolase family 26.
COG4124	ManB2	6.47e-15	146	286	164	322	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM01251.1	1.45e-209	1	313	6	334
CBK82137.1	1.27e-161	4	312	5	311
AEB13973.1	2.81e-155	3	313	4	310
AZK45707.1	1.10e-126	5	313	8	314
AOZ93051.1	1.73e-126	5	313	11	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	9.05e-62	7	312	10	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	1.80e-57	5	313	147	444	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	1.61e-49	6	313	37	349	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	9.88e-41	8	285	50	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	1.34e-39	1	312	21	323	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	3.62e-59	5	313	176	473	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	4.36e-57	5	313	30	347	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
A2R6F5	2.93e-52	5	313	30	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P49425	2.20e-51	4	289	147	433	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55296	2.79e-41	5	313	159	457	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000583_00284.