CAZyme Information: MGYG000000584_01682

Basic Information

• Species: RC9 sp900544195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900544195
• CAZyme ID: MGYG000000584_01682
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771	MGYG000000584_41|CGC1	87080.06	6.4593

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000584	3056711	MAG	Madagascar	Africa

• Gene Location: Start: 21602; End: 23917 Strand: -

Full Sequence      

MIKRILTVFAALAVALSVSAAEYDGKWIGCAYEGDILKGNTVLPARYLRKEVTLDGKVKE
ATLRISGLGVYDTWINGEYITRDQELSPTVSEYRIRVYFNEFDVRKALKKGQNALAVSLG
CGRYTTMREPGMKGFGLPRLWYRLDIVYTDGRTATIVSDESWKITCEGPIRANNEFDGET
YDARKELTGWTKVGYDDSAWAKASLMDAPGGRLVLQPNPNIAVQDIVKPVSITKTDHGYI
LDMGQNMVGRLQIKARGLQRGDTLTMKFAELLNPDGTLYLANLRTAKVLDTYIAKDGKPI
VWHPEYVYHGFRYVEIKGLKNEPKLGDFEGQVMYDKMAVTGHFETSNPVINQIYHNAFWG
IRGNYRGMPTDCPQRDERLGWLGDRTMGCYGESYIFNNHALYSKWLTDIHDGQNEAGSIS
DVCPRYWTLYQDNFTWPGAFFTGADMVYRRFGDDRSIKDHYGAMKKWLEYMRSKYLKDGV
MIKDTYGDWCMPPESLELIHSQDPARKTASPLISTPFYFFLLNKMIEFAPIAGHPEDVKI
FNEYAAAAREAFNAKYFNAKEGFYGNNTVTANLLPLYFGMVPDGREGDVFEHVVHKTEVD
CDGHVSCGVVGMMVLMRTLTEFGRPDLALKIATNETYPSWGYMAKNGATTIWELWNGNTA
DPAMNSGNHVMLLGDLVTWYYEYLGGIRPAEPGYKSIELKPYPIEGLDWVNCSYDSPYGK
IVSNWKRTGDKFEWTVEIPAGTTATALIPGSDSSRETKTLAPGKHRFVTEL

Enzyme Prediction     

No EC number prediction in MGYG000000584_01682.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	235	745	9.7e-166	0.9841269841269841
CBM67	43	210	1.5e-36	0.8977272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.39e-118	340	684	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.32e-51	56	223	1	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	7.72e-31	239	334	8	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.34e-24	686	757	1	72	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAH06301.1	4.44e-317	21	770	137	884
QCT77149.1	4.44e-317	21	770	137	884
CUA17183.1	3.61e-316	21	770	137	884
BAD47345.1	5.11e-316	21	770	137	884
AKA50625.1	7.22e-316	21	770	137	884

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.46e-157	41	749	172	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.76e-126	45	771	302	1032	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	4.38e-99	49	755	135	853	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	2.94e-125	21	753	147	883	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	5.48e-125	45	755	302	1001	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	6.79e-111	22	749	145	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	1.02e-88	45	748	184	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000216	0.999171	0.000171	0.000152	0.000147	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000584_01682.