CAZyme Information: MGYG000000584_01911

Basic Information

• Species: RC9 sp900544195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900544195
• CAZyme ID: MGYG000000584_01911
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000000584_53|CGC1	43218.78	6.9111

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000584	3056711	MAG	Madagascar	Africa

• Gene Location: Start: 10115; End: 11275 Strand: +

Full Sequence      

MRYYIIAGEASGDLHGSNLMRGLYAEDPQADIRFWGGGLMDEVYHGHQDGTGLVKDYKDG
AVIGFTQILVHARAFAKRFTDCTSDILAWKPDVVILIDYPGFNFRVAEFAHKAGFKVFYY
IAPKVWASRESRVKKLKAFVDKLFIVFPFEIPYFTKKGVDFIYKGNPLIDAIDNSEAFKE
TREEFLAKTGLPDKPMIALLAGSRNGEISSMMPTFMAFADKLHAIPEYSEYRFVVAAAPA
RSEADYTKYIGGREHVSVVFGQSYAVMRHAKAAVVNSGTASLECALIGTPQVVAYKGAEI
NFLIAKMIIKIQYISLGNLILDRICFRELLQYYFTPDNVLNEVRRMIEDEEYRSAMLSGY
QEIRDALGGEGASAAVARAMIGELRQ

Enzyme Prediction     

No EC number prediction in MGYG000000584_01911.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	367	1.4e-106	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.54e-110	1	386	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.09e-104	1	386	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.49e-78	4	368	2	360	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.36e-62	5	381	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.21e-53	1	378	2	342	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY31424.1	2.16e-114	1	381	1	370
SNV26174.1	2.16e-114	1	381	1	370
AGY53532.1	7.81e-113	1	385	1	371
AZS31618.1	4.55e-111	1	384	1	373
ASB47927.1	1.77e-110	1	386	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.21e-37	5	367	11	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.17e-36	5	367	11	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	1.28e-72	2	386	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	1.86e-65	2	377	8	373	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	1.45e-64	2	377	8	373	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2LVL8	1.30e-61	5	373	8	367	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	9.88e-57	2	381	6	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999971	0.000065	0.000003	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000584_01911.