CAZyme Information: MGYG000000584_02019

Basic Information

• Species: RC9 sp900544195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900544195
• CAZyme ID: MGYG000000584_02019
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
749	MGYG000000584_60|CGC1	85000.47	7.1507

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000584	3056711	MAG	Madagascar	Africa

• Gene Location: Start: 12576; End: 14825 Strand: +

Full Sequence      

MTMKLSNLIRKTVLAAALTLTSASFAGAESRSDWKAHWITHPWVQSTTNTWISYRKEVNV
TKRPDKLVAKIAVDSKYWMWINGELAVFEGGLKRGPFPNGTYYDKVDIAPYLKEGSNTIA
ILLWHFGKQGFSHNSSGQAALIFEAISPELKILSDKSWLCIPNPAYGDTDAPHPNYRLSE
SNIRFDARKEHPGWNMPGFDYGRKMHWADNVDEMAWPAMGELVERPIPMWKDYGLKEYVS
VRQSNDTVYCKLPYNAQVTPYMKVEANGGEMVRIMTDNYRGGSENNVRAEYIARKGVQEY
ENLGWMNGHEVWYIVPSGVKVIDLKYRETGYDTEFSGSFECEDPFLNELWKRAARTLYIT
MRDTYMDCPDRERAQWWGDEVNELGEAFYALSPSGQLLARKGILELVNWQEANGVLYSPV
PAGNRVIELPLQMLASVGWYGFHTQYWFSGDSTFVAEVYPKVQRYLLGTGLWEFKDNGLL
NVRQGDWNWGDWGDDIDTEVLTNCWYYLALKSQKEFARIFGKQRDAETIEALMKRISDAF
DARYWTGTSYRDPNYKKQTDDRAQAMAVVSGLASSDKYPALFETLKKEYHASPYMEKYVL
EALFKMGHADFAIERMKSRYAKMLKYDYTTLFEGWGIGSEGFGGGTINHAWSGGPLTILS
QKLCGIEPTAPGFQTFDVKPQLGTLKTASAALETHYGMIRVSISRKSVKSHVASLAIEVP
EGTTATVKASNGKPKTMTAGKYSLKIKVD

Enzyme Prediction     

No EC number prediction in MGYG000000584_02019.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	269	728	5.4e-90	0.9226190476190477
CBM67	36	201	2.2e-32	0.8977272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.97e-27	334	655	1	332	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	7.68e-10	665	728	1	62	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.76e-09	77	228	16	166	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
COG3408	GDB1	1.09e-04	449	552	355	469	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam06202	GDE_C	3.06e-04	449	545	100	211	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48047.1	0.0	18	745	7	730
QUT95158.1	0.0	34	744	31	737
QUT19199.1	0.0	34	744	31	737
AST53791.1	0.0	34	744	31	737
ABR43077.1	0.0	34	744	31	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	9.05e-34	264	742	463	954	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
6I60_A	5.05e-22	27	720	138	889	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.81e-14	103	727	356	992	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	9.86e-14	103	727	356	992	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KM26	1.09e-11	500	720	904	1127	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000355	0.998871	0.000225	0.000201	0.000174	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000584_02019.