CAZyme Information: MGYG000000584_02276

Basic Information

• Species: RC9 sp900544195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900544195
• CAZyme ID: MGYG000000584_02276
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
841		94321.29	5.6541

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000584	3056711	MAG	Madagascar	Africa

• Gene Location: Start: 6564; End: 9089 Strand: -

Full Sequence      

MKRDKLLIAVTFGLLLTGTASAAPGTRTYSGKELDHIAFPIGGLGSGMFCIEGTGAISNV
SFHHYPQMFNEPCTFAALHLKGVENGTKVLEANVPSYKIFGRRDGGMGVGGTTWGLPRFD
DATFTSEFPFATINLKDKDMPVVVSITGWNPFIPNDEDNSGLPVGGLEYSFKNTSGSMVE
GIFSFNTKNFMKRNDTAPSPISKMEKGFVLNQNPVEGAPESEGHCAVFTDAPGTTVDYCW
FRGGWFDPLTMAWNKVVKGDTTANEPTEDGSGASLYVPVTIKPGETKTVRLYIAWYVPRS
FHRIGPDAESESDFGDYYSADLYKDTPKYYEPWYSRRFRDVAEVASYWKSNYDNLKKETR
NFTETFYDTTLPTEVVEAISNNLTILKSATLMRQYDGRFWAWEGCGDDWGSCHGSCTHVW
NYAQALPHLFPRMERSLRETEFYVDQNKEGHQAFRANIPIRPVKHDFHSAADGQLGGIMK
VYREWRISGDNDWIKAIYPQVKKSMDYCISTWDPDEVGAVIEPHHNTYDIEFWGPDGMCT
SFYAGALNSIVHIGKALKENVSRYEKLLAKAQEYMKINLWNGEYFYQDVRWKGLKASDPT
SAQSLFEDGYSPEAKVILAKEGPKYQYGTGCLSDGILGCWMSLVCGLDEPIDKELVTKHL
ESIYKYNLKEDLRDHSNPQRPGYAVGNEGGLLLCTWPKGGKPELPFVYSDEVWTGIEFQV
ASHLILEGKVDEGLKVVKTCLDRYDGTIRNPFNEYECGSWYARAMSSYSLIQAMTGVRYD
AVDKTLYIDSKVGDNFRSFLSTASGYATVGLKDGKPFIENRNGHIDIKKCFVSGKKMAIS
E

Enzyme Prediction     

No EC number prediction in MGYG000000584_02276.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	397	770	2.8e-61	0.9944903581267218

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04685	DUF608	8.74e-67	397	770	1	362	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
pfam12215	Glyco_hydr_116N	1.26e-47	38	355	1	309	beta-glucosidase 2, glycosyl-hydrolase family 116 N-term. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 320 to 354 amino acids in length. This domain is found associated with pfam04685. It is found just after the extreme N-terminus. The N-terminal is thought to be the luminal domain while the C terminal is the cytosolic domain. The catalytic domain of GBA-2 is unknown. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335 in the downstream family pfam04685.
COG4354	COG4354	5.57e-36	26	778	2	721	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT37400.1	0.0	27	836	34	844
QBJ18460.1	0.0	27	836	34	844
QDO68263.1	0.0	27	836	33	843
QNL50572.1	0.0	29	837	59	869
QUT60790.1	0.0	29	839	34	851

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9HCG7	4.76e-16	114	740	219	848	Non-lysosomal glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA2 PE=1 SV=2
Q69ZF3	1.13e-13	114	740	210	839	Non-lysosomal glucosylceramidase OS=Mus musculus OX=10090 GN=Gba2 PE=1 SV=2
Q5M868	5.84e-13	114	740	210	839	Non-lysosomal glucosylceramidase OS=Rattus norvegicus OX=10116 GN=Gba2 PE=2 SV=2
Q7KT91	2.52e-08	493	735	687	893	Non-lysosomal glucosylceramidase OS=Drosophila melanogaster OX=7227 GN=CG33090 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000285	0.999014	0.000193	0.000182	0.000164	0.000142

TMHMM  Annotations     

start	end
7	29