CAZyme Information: MGYG000000586_00010

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11
• CAZyme ID: MGYG000000586_00010
• CAZy Family: GH59
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1093	MGYG000000586_1|CGC1	119791.13	5.1625

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000586	2012106	MAG	Madagascar	Africa

• Gene Location: Start: 12164; End: 15445 Strand: -

Full Sequence      

MKKSLRRIGAAVLSAVMVMSSIPGGSPVTARVSAQETKTQECKVHLNGDDIRTDSVNGLT
FKGFGLLSANSTSDLLMDYKVEHPEAYNQLIQYLFGGDRPIMNHVKLEMGNDRNTSTGAQ
TCTKRTQDEKANVTRDPSWQLAADAKKVNPKVKVSILKWCAPAWANTAQKQYQWYKESIL
AAYETYGYMVDYINPNTNERWSETGDPANTKQWAKWIAQEDETTIPDADALEAYHKIKLV
ISDEAGTVSDSVAYNLQQDQEFMDATDVVGYHYSPWDDTKGRMKWLADEVDKEVWNSEAQ
ATFSNSYFRPSNNSKDGTFDADTSGSIGGTGSALEMANTFIKGFVESRRSHIIYQPAIGS
FYEGGQYSFKELVSARDPWSGYIHYDTGLLILEHLARFAKTGWENEDNTEGIWRGVVSAS
KTSADGTNPVNGRNGGANYITLAAPTKDDFSTMIVNDSDYTQNYTLSVENMKLDENQKLE
LWETRAADDGAYDENYMKDLGTVEAKDGTYTFTVKPYSTVTVTTLELSQEEKEELALPKD
TERTVLDVDQGDGTLYADDFEYSDEYMDMRGGQQGASVRYGHNVNGAFESYLTESGNHVL
RQQLDKETMGVGSAWGQGDANVLIGDFRWANYTASVDVNFESTASKSYAAVAIRQYGSNT
KLAGSAGYTLRLDPTGEWTLYRLTKTAATGTLTEADGFRAGSGAWNHLSLSGNGATITAC
INGKEVAVYVDDTPITSGRVGLGSNYSFTQFDNLKVTKIAGTSPYYKELLDNMETYDLTD
QKNAKLIYSDGWSRYNGCGMYCYQRSMSSTSQAGATLTYTFEGTGLELLAAAKKSCKIRV
TVDGNVAEEADTYATKNDNQTIYSLNGLSYGTHTVQIELVSGTLYVDTVGILSDTYGEVP
AEPTQEPLQTQEPQQTQEPQQTQTPAQQTQTPAPAPAQQTQEPTPQNGQSVSDGTADYTV
TDAAAQTVTYRAPANAKASGVIVPDQVTITAGTQKITYKVTAVADNAFAKNKKLKSVVIG
KNVTTIGKKAFFKCSSLKKIKIKSTSLKKVGAKAIQGIASKAVITCNKKCLKNYKKLFSS
KTGYKKSMKIKKG

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH59	54	756	7.4e-175	0.993660855784469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02057	Glyco_hydro_59	1.39e-89	61	397	1	293	Glycosyl hydrolase family 59.
sd00036	LRR_3	4.37e-10	995	1065	20	89	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
sd00036	LRR_3	5.57e-10	999	1074	1	77	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
sd00036	LRR_3	9.55e-10	996	1069	44	116	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
sd00036	LRR_3	1.79e-09	995	1057	66	127	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACL75594.1	1.02e-273	46	902	36	921
ABG76970.1	1.02e-273	46	902	36	921
QUL53185.1	1.68e-273	34	909	307	1206
AUX40340.1	5.85e-271	44	892	57	932
QNK59157.1	8.61e-270	34	900	305	1197

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5X3C1	4.28e-23	58	756	34	662	Galactocerebrosidase OS=Salmo salar OX=8030 GN=galc PE=2 SV=1
Q0VA39	5.88e-23	54	756	38	672	Galactocerebrosidase OS=Xenopus tropicalis OX=8364 GN=galc PE=2 SV=1
Q498K0	1.52e-20	58	756	44	671	Galactocerebrosidase OS=Xenopus laevis OX=8355 GN=galc PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000353	0.998853	0.000228	0.000234	0.000171	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000586_00010.