CAZyme Information: MGYG000000588_00076

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; ML615J-28; CAG-313; UMGS75
• CAZyme ID: MGYG000000588_00076
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489		56421.78	6.5102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000588	1739916	MAG	Madagascar	Africa

• Gene Location: Start: 4262; End: 5731 Strand: +

Full Sequence      

MSNIEKEIKKITFVTSECQPFIASGGLGDVTGSLPQRIVKAGKGEYQLNVILPYYSKINP
AYRNKLVYVGQITVNLAWRKQYCGIFKYEDKYVTYYFIDNEYYFKRDNLYGYFDDGERFA
YFSKAAIEVMLHLNMVPDIIHVHDWQAGLVPIYLRTLYFGDIRLMNVKTVFTIHNIEYQG
QYSFDDDIIEDVFGISLNDSYIFEYHNSINIMKGAMEAANYVTTVSPSYAEEILTPEYAH
NLEDETRRIKEENKLIGILNGIDKNFYNPAKDKALFVTYDRHDFTNKKLNKIELQRMLNL
PTDENIPMIGMVTRLVSHKGLEFIKSAFDELMTLPIQLVILGTGDPYYEGYLKDMEVKYN
HKVRTIIAFNQDLSRKIYGASDLFLMPSKSEPCGLSQMIAARYGAIPMVRETGGLKDSII
DFSKPNGIGYTFEGMDYHAMLDMIKRAVNDYNNKEEWIKKVSATMNADFGWSASAKKYLA
MYQAILKNK

Enzyme Prediction     

No EC number prediction in MGYG000000588_00076.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	10	483	1.6e-158	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	10	483	1	473	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	10	488	2	466	glycogen synthase GlgA.
TIGR02095	glgA	3.81e-180	10	485	2	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	2.40e-170	10	486	2	479	Glycogen synthase [Carbohydrate transport and metabolism].
PLN02939	PLN02939	7.86e-94	11	483	484	965	transferase, transferring glycosyl groups

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB40510.1	1.93e-158	10	488	2	475
QQR29794.1	1.93e-158	10	488	2	475
ANU52824.1	1.93e-158	10	488	2	475
BCI60006.1	1.56e-157	10	485	2	472
QNO18264.1	1.29e-153	10	487	2	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNE_A	9.65e-79	11	482	12	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
3D1J_A	5.45e-76	10	482	2	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.32e-75	10	482	2	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	1.01e-74	10	482	2	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
4HLN_A	1.77e-70	4	483	120	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7GK04	1.20e-144	10	486	2	475	Glycogen synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) OX=491915 GN=glgA PE=3 SV=1
A6TSC8	5.31e-141	10	485	2	474	Glycogen synthase OS=Alkaliphilus metalliredigens (strain QYMF) OX=293826 GN=glgA PE=3 SV=1
A4IS20	7.36e-141	10	489	2	478	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
O08328	2.96e-140	10	489	2	478	Glycogen synthase OS=Geobacillus stearothermophilus OX=1422 GN=glgA PE=3 SV=1
B9MPC0	2.45e-137	10	488	2	478	Glycogen synthase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) OX=521460 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000588_00076.