CAZyme Information: MGYG000000588_00528

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; ML615J-28; CAG-313; UMGS75
• CAZyme ID: MGYG000000588_00528
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486		56776.89	6.2064

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000588	1739916	MAG	Madagascar	Africa

• Gene Location: Start: 7503; End: 8963 Strand: +

Full Sequence      

MRGCGILLPVSSLPGKYGIGTFGKEAYDFIDLLKKMNQTYWQILPLGPTTFGDSPYQTYS
TFAGSENYLNLEELYQDKLITKKELDSMVTPLSNVDYVKLKETRLPLYKKASKKFFQKLP
QDFENFQKANESWLEAYVTFRSLKEYYQGKCFNEWDEDVIKGHLSEEIKEKIAEDKNMHL
FIQYYFFKEWLSLKEYANKQGIKIIGDLPIYVSYDSSDVWQNPKNFELDEDLRPTRVAGC
PPDAFSSDGQLWGNPLYDYKEMKKTSYKWWVERIIHSLKMFDVLRIDHFRGFAGFFAIPA
TDKTAKNGVWEKGPGFDIFEELFKKVTNPKMIMEDLGYLTPDVYQLLKKTKFPGMRVLEF
AFDGRKENDYLPHNYLQNTVVYTGTHDNMPLVGWVKTLSKDQVNQIFNYFNITKVNEIPD
TLIKAALASIADTAIIPLQDYLHLDENSRINTPSTVGNNWSFRIDLKLVTEETIETVKEY
VKKYYR

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	8	478	3.7e-150	0.9817813765182186

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	0.0	1	486	4	496	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	0.0	8	466	1	459	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	6.18e-172	2	464	28	500	disproportionating enzyme
COG1640	MalQ	2.58e-153	1	486	13	514	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	3.85e-120	5	464	17	491	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK94656.1	4.41e-181	1	486	1	490
CBK90516.1	8.86e-181	1	486	1	490
AYB00692.1	6.58e-174	1	486	1	496
CBL21914.1	3.79e-173	1	486	1	492
ADL50291.1	6.38e-173	1	486	1	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TZ7_A	9.08e-133	1	483	21	496	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
6M6T_A	4.39e-131	2	486	5	496	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
1X1N_A	4.93e-123	2	464	26	498	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	2.35e-122	2	464	78	550	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]
5CPQ_A	1.31e-121	2	464	70	538	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59266	5.38e-151	10	486	3	485	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
P0A3Q1	3.16e-149	2	486	4	495	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
P0A3Q0	3.16e-149	2	486	4	495	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
O66937	1.49e-131	1	483	1	476	4-alpha-glucanotransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=malQ PE=1 SV=1
P72785	2.36e-124	2	463	5	476	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000588_00528.