CAZyme Information: MGYG000000589_01077

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium
• CAZyme ID: MGYG000000589_01077
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		33913.21	5.0796

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000589	2241135	MAG	Madagascar	Africa

• Gene Location: Start: 3032; End: 3979 Strand: -

Full Sequence      

MLCITVAQDGSGDFASVSEAVLAVPYDCPAEIRIGAGVYREKLVCEKRDITLRGAGADCT
RLVWGDGGKLPHPDGRPTHTFRSYTAFFSGERLRVEDLTIENDAGPGAKVGQAVAAYVDS
ACAVFEKVRLLGNQDTLFCAPLPEKEREKDGFLGPRGLAPRRQTAQYYHDCEITGDIDFI
FGGADALFEQCVLRTVNNGLPHSWVTAPSGPAEGLGFVFWDCDFVSDGCPDGSVYLGRPW
RPTGKTAVLDSRLGVHISPEGFAPWHDRADSALAGFAEAGSTGKGACQRSPWVKALDAAQ
AQELLCTARRLCRPE

Enzyme Prediction     

No EC number prediction in MGYG000000589_01077.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	304	1e-73	0.9652777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.96e-52	6	303	87	395	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	3.27e-50	4	292	2	274	Pectinesterase.
PLN02773	PLN02773	2.43e-43	4	305	7	291	pectinesterase
PLN02682	PLN02682	4.11e-39	4	305	71	356	pectinesterase family protein
PLN02497	PLN02497	6.89e-37	4	304	34	314	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB27671.1	4.79e-194	1	315	1	314
CBL01447.1	4.79e-194	1	315	1	314
AXA81880.1	6.40e-184	1	315	1	314
CBK98674.1	4.30e-182	1	315	1	314
QIA44050.1	7.42e-180	1	314	1	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	2.72e-29	6	265	7	248	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	2.81e-27	4	286	9	273	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	4.24e-22	13	286	43	335	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.63e-18	7	257	12	276	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1C_A	7.14e-16	3	285	10	265	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.20e-37	4	296	7	282	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	2.00e-31	6	313	260	552	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q8VYZ3	2.41e-30	8	305	90	370	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q43062	3.36e-30	6	266	211	454	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
Q96576	1.71e-28	6	273	235	481	Pectinesterase 3 OS=Solanum lycopersicum OX=4081 GN=PME3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000589_01077.