CAZyme Information: MGYG000000589_01402

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium
• CAZyme ID: MGYG000000589_01402
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238	MGYG000000589_133|CGC1	27401.31	4.9597

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000589	2241135	MAG	Madagascar	Africa

• Gene Location: Start: 5298; End: 6014 Strand: -

Full Sequence      

MWLDGTYMAQPFYMEYETRYNKMQGCIDSYKQFMNIQKHMRDETTGLYYHGYDESRQMYW
ADPVTGCSPNFWLRAMGWFMVAMVDVLERMDEQLYNEYRGIMAMLKQTIEDVHKFQDEET
GMFWQVMDHPGVEGNYLETSGTALFAYAVLKGVRLGYLPGRMAAWAEKAFYGTCDKYLSK
NPDGSLQLDGICLVAGLGGKDHRDGSLAYYFSEPVVCNDAKGVGPLVLAYTEMIARKK

Enzyme Prediction     

No EC number prediction in MGYG000000589_01402.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	1	234	2.2e-75	0.6506024096385542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	3.99e-60	1	233	132	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.01e-49	1	237	126	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK99741.1	1.51e-177	1	237	145	381
AXA82451.1	6.13e-177	1	237	145	381
ATP00557.1	7.13e-176	1	237	145	381
QIA43718.1	7.13e-176	1	237	145	381
AXB29657.1	7.53e-171	1	237	145	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.81e-66	1	232	127	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.28e-45	1	233	140	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.64e-45	1	233	130	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	8.09e-13	32	186	197	338	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	7.56e-11	21	186	187	339	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A3U6	4.07e-46	8	234	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.07e-46	8	234	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O34559	7.03e-45	1	233	140	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	1.63e-06	2	155	133	274	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000589_01402.