CAZyme Information: MGYG000000590_00751

Basic Information

• Species: Rs-D84 sp900549365
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rs-D84; Rs-D84; Rs-D84; Rs-D84 sp900549365
• CAZyme ID: MGYG000000590_00751
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587		64721.27	9.6301

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000590	860151	MAG	Madagascar	Africa

• Gene Location: Start: 5791; End: 7554 Strand: +

Full Sequence      

MSRQQNIDTAPEKKRPSWRWRLVLLLMNLVLVGAAAVAVYLTIIFLQMPSLDAILHETRP
AAVVFLDKNGEEIRSAGRIMGTPVSVETLPPHVWQAIVAIEDKRFFEHGPIDMRGITRAM
LSNAVHGRIAAGGSSITQQTAKNIFLSREKKISRKAQELILSYWLENRFDKNQVLDLYMN
RVSLVGGMRGIDAASRVMFQTPANEMTIAQAAQIAAMLKAPTSYSPLKNPERNIKRARVV
LQEMVRQGYITLNQARAAARDLSPATPAPDTNIYRYWTDFVLDEVRSRIGALDSDLLVYT
TLDMKLQERVATILPAHTDKYQGAVVAMTPSGAVRAMVGGTDYQTSQFNRTTTMRQPGSS
FKPVVYLVALEHGMTPDSYVNDSPFAIGDYNPKNYNERYYGDITLATAFAKSVNSVPLKL
TETYGIDSVLDMAGRLGVGTKLRREYSTVLGASEMSLVDLTTIYAVIWNNGASVRPYSIT
KITDPRGNVLYARNPSDALQVLQPQTVEYMTDLLADVVVRGTGRRANATGVLGGKTGTSN
NNRDAWFVGAVCDLVIGVWVGNDDFSPMSSKITGGTIPAEIFHDIVK

Enzyme Prediction     

No EC number prediction in MGYG000000590_00751.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	73	245	2.6e-58	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	0.0	81	585	2	524	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	6.46e-170	59	585	52	592	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.77e-141	40	584	26	713	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	1.43e-95	96	587	162	680	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
TIGR02073	PBP_1c	1.16e-85	54	586	3	540	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWK85684.1	1.19e-149	20	582	8	571
ACJ00075.1	1.03e-144	47	586	60	607
QCO14987.1	1.79e-143	46	582	102	644
QCO02797.1	2.25e-143	46	582	101	643
AWJ88325.1	2.39e-143	46	582	101	643

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UDF_A	8.93e-77	73	575	31	701	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
4OON_A	6.35e-68	68	582	26	715	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5FGZ_A	5.24e-54	90	582	165	686	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	6.55e-54	90	582	186	707	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3ZG8_B	1.40e-51	165	563	3	433	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66874	1.45e-90	39	587	21	665	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P38050	8.54e-81	40	586	27	594	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
Q1RKC5	2.74e-77	84	586	70	713	Penicillin-binding protein 1A OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=mrcA PE=3 SV=1
O87626	8.28e-77	32	586	21	701	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
O87579	2.22e-76	32	587	21	703	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.960520	0.000416	0.000019	0.000003	0.000001	0.039060

TMHMM  Annotations     

start	end
22	44