CAZyme Information: MGYG000000591_01322

Basic Information

• Species: Phascolarctobacterium_A succinatutens_A
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A succinatutens_A
• CAZyme ID: MGYG000000591_01322
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000000591_18|CGC1	40564.88	7.4352

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000591	2471478	MAG	Madagascar	Africa

• Gene Location: Start: 35605; End: 36705 Strand: -

Full Sequence      

MQKTRKKYTVLLLSAPIGSGHRLAAEALEQAFADRPEVEVIHGNIFDFFPQLLGKAFLGT
YLWILKCCPWLYKLAYSWGNKQGGSLWLRELLNRLLARLGGNYLRSVQPDAVIATHATPA
GIIGYYKKQHPGLWLGAVVTDFTIHRWWVCDGVDTYFIADELLRDKLETTADIQATGIPV
RQQFMIKHDKQKCREFFGWDENERVCLLMGGGEGLLPMAEIIAALQRAALKNLRVVAVTG
HNEALAAQLQAKYGATAEIYGFREDVPQLMAGADMIITKAGGLTSAEVLASGLDLLIYKP
LPGQEEGNAAFLQQYCGALVARSTDELVQHIKNSTVSPRETAACSEHAHPLAAQQIVDYV
MQRLQK

Enzyme Prediction     

No EC number prediction in MGYG000000591_01322.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	207	353	1.2e-26	0.9617834394904459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	2.46e-55	10	359	1	358	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK13609	PRK13609	4.48e-42	10	362	7	367	diacylglycerol glucosyltransferase; Provisional
PLN02605	PLN02605	4.77e-27	10	358	1	373	monogalactosyldiacylglycerol synthase
COG0707	MurG	2.18e-23	11	358	3	349	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam06925	MGDG_synth	9.38e-18	21	180	1	169	Monogalactosyldiacylglycerol (MGDG) synthase. This family represents a conserved region of approximately 180 residues within plant and bacterial monogalactosyldiacylglycerol (MGDG) synthase (EC:2.4.1.46). In Arabidopsis, there are two types of MGDG synthase which differ in their N-terminal portion: type A and type B.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV77563.1	2.73e-263	1	366	1	366
QNP76577.1	5.03e-137	1	366	1	374
BBG63986.1	2.03e-136	1	366	1	374
QJW47959.1	9.14e-77	6	328	3	333
BBB93200.1	2.19e-70	10	358	6	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WYI_A	2.33e-20	10	317	8	333	Thecrystal structure of Arabidopsis thaliana galactolipid synthase, MGD1 (apo-form) [Arabidopsis thaliana],4X1T_A The crystal structure of Arabidopsis thaliana galactolipid synthase MGD1 in complex with UDP [Arabidopsis thaliana]
7D1I_A	3.82e-07	149	360	148	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FED1	4.08e-35	4	333	3	334	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus pumilus (strain SAFR-032) OX=315750 GN=ugtP PE=3 SV=1
Q65IA4	1.09e-33	10	333	7	334	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ugtP PE=3 SV=1
A7GKY0	2.18e-31	6	362	3	367	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) OX=315749 GN=ugtP PE=3 SV=1
Q81IA1	4.18e-31	6	327	3	328	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=ugtP PE=3 SV=1
P54166	5.25e-31	10	331	7	332	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=ugtP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.990638	0.009323	0.000029	0.000017	0.000010	0.000014

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000591_01322.