CAZyme Information: MGYG000000592_00112

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000000592_00112
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
735		83436.24	5.989

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000592	2977283	MAG	Madagascar	Africa

• Gene Location: Start: 257; End: 2464 Strand: +

Full Sequence      

MFAHRLIVCVAAGVTLAATMLSAQEVWKARWIGKQECRSEANSWLAFKKEVNVSEVPDEM
VARIAADSKYWLWINDSLAVFEGGLKRGPSPGDTYYDEIDIAPYLRKGENCLSVLVWHFG
RNGFSHADSGVAGLLFEAKAPGFEILSDKTWDATVYKAYGTAGEPEANYRLPESNLSFDA
RKDITNWCSPSAPRLGRAMELPVIVGEPPFGKLVKRPIPMWKCTGLMDYPEVRRSGDTLV
CSLPYNAQITPYLKVKAPAGRTIKMLTDHYKVALAKTQCLWCEYITRDGVQEYESLGWLN
GDKMMYIVPSDVEVIDVKYRETGYDTEITGTFECDDPFLNEYWRKAVRTLYVCMRDTYMD
CPDRERAQWWGDEVNELGMAFYSLSPSSWKLAEKGIYELMNWQRVDGVLSSPVPAMNYSA
ELPSQMLAALGWYGFYTQYFYSDNNAFVPVVYDRMKKYLHKVWKLDEDGLPIYRTGDWDW
PDADSPVDKYALMPCLYYLALKSELEFARMLGRAEDVAMIESVMARLKDSYNRLYWTGNG
YRSPSYKDRTDDRPQAMAVLSGIASEEKYQVISEILKTTDMASTYMEKYMVEALFVTGQS
SAALDRMKRRMATIMDDRSSTLYEHWNWTNSSNHAWSGANIILLCQKVCGVAPLTPGFKT
FSVRPQMGWLKRASTSFETKYGTIRVSLTRKSSKSKTAELTIDVPEGTEAQVVLPNSKTS
VLASGQHTLNVKADF

Enzyme Prediction     

No EC number prediction in MGYG000000592_00112.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	308	714	6.3e-81	0.8253968253968254
CBM67	29	190	1.1e-24	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.57e-22	329	639	3	331	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	5.60e-15	650	727	1	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3459	COG3459	8.35e-05	451	568	713	846	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam08531	Bac_rhamnosid_N	1.36e-04	91	219	32	166	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
COG3408	GDB1	2.29e-04	481	572	411	503	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48047.1	2.97e-297	6	727	10	727
QCY56550.1	7.94e-295	27	727	31	735
ABR43077.1	1.60e-294	27	730	31	738
QRO16732.1	1.60e-294	27	730	31	738
QIX67102.1	2.35e-294	27	730	32	739

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	9.66e-27	105	715	294	942	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
6I60_A	2.10e-22	19	715	137	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	2.29e-13	310	702	710	1126	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.224874	0.771668	0.002577	0.000293	0.000255	0.000315

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000592_00112.