CAZyme Information: MGYG000000592_00547

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000000592_00547
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000000592_45|CGC1	54320.73	4.8379

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000592	2977283	MAG	Madagascar	Africa

• Gene Location: Start: 3574; End: 5025 Strand: -

Full Sequence      

MVVLLILAIGGTACSHNGTDPEPTPPEPPVQETNLDKAEENLKRSLTLTQAALERCFKGN
SMLMMRYYYPFTGETSLEKASVWMYTSSFEAVNALLSGMEELKEAGRPDLYNANSDELKS
TLGKLFDGLDWYKGTYTLTSYTQTKEWSVYGVNRGNSPGTAKVEGRENVYDDQEWLVREL
LNAHRLTGESRYLEKAEYLAEYVLDGWDCTLKSDGTEHGGITWGPGYYTKHSCSNGPFVS
PLVWLSEIYSGKTAKITHRYIGAMKQRLTEEMDKSEYYLMFAKKVYAFQKNNLFRKTVGV
YYDMLGAKGSSLSESGIAYETVGGVRYRANNEEEGPTGTAYSYNSGTMLSGAADLYRVTG
DKEYLTDMTNLSNSALVYFAKKSATVEDCYDYDVTGFNNWFNGVLLRGWVDVSAHYSNVT
LNINTFQNNLDYGYTNYLHDGFLPPSLLYGWNTDNTKNKVEGMFAFAFAAEYAEIARYLI
STK

Enzyme Prediction     

No EC number prediction in MGYG000000592_00547.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	153	415	4.8e-39	0.5307262569832403

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	4.71e-14	170	379	86	255	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	1.78e-04	170	412	92	277	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
cd01810	Ubl2_ISG15	0.002	161	202	28	59	ubiquitin-like (Ubl) domain 2 found in interferon-stimulated gene 15 (ISG15) and similar proteins. ISG15, also termed interferon-induced 15 kDa protein, or interferon-induced 17 kDa protein (IP17), or ubiquitin cross-reactive protein (UCRP), is an antiviral interferon-induced ubiquitin-like protein that upon viral infection it modifies cellular and viral proteins by mechanisms similar to ubiquitination. Although ISG15 has properties similar to those of other ubiquitin-like (Ubl) molecules, it is a unique member of the Ubl superfamily, whose expression and conjugation to target proteins are tightly regulated by specific signaling pathways, indicating it may have specialized functions in the immune system. ISG15 contains two tandem Ubl domains with a beta-grasp Ubl fold. This family corresponds to the second Ubl domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH77939.1	2.76e-178	13	478	20	477
AGA76828.1	4.50e-177	13	478	20	477
AWW30266.1	7.34e-176	13	478	20	477
SCD21417.1	2.49e-174	1	478	12	478
QIK53975.1	5.01e-168	1	478	5	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	3.54e-15	170	409	117	300	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4C1S_A	1.27e-12	165	441	102	334	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6SHD_A	3.09e-09	167	415	130	326	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	5.28e-08	167	415	131	327	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	2.88e-07	167	415	131	327	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.022653	0.258018	0.718593	0.000317	0.000209	0.000210

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000592_00547.