CAZyme Information: MGYG000000592_01344

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000000592_01344
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		44940.64	4.9592

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000592	2977283	MAG	Madagascar	Africa

• Gene Location: Start: 2494; End: 3684 Strand: -

Full Sequence      

MRKSIIATFALLPLVFGCGGKESMSDLTDRVFKVAEEQYLAMEDRLTGDTMPRSFSNDGE
FIASNIKWWCSGFYPGTLWYIYEYSGDPQFKGIARKNTLKLDTLKTMKGTDHDLGFQMNC
SYGNAYRITGDKEYLEPILTSAKTLAKRFSPVTGVIRSWDFVREGRDWKYPVIIDNMMNL
EHLYNAGRIFNDDSLKTVAVTHANTTMCNHFRQDYTSWHLVDYDPQTGEVRKKETVQGFS
DDSAWARGQAWALYGFTMMFRESGHDSYLTQARNVADMLLSRLPEDGIPYWDFDSDKIPN
DLRDASAGAIMASAFVQLSTLTDDEASNAKYLAMAEKQLRTLASPEYLAEPGTNGNFILK
HSVGSLPDNSEVDVPLTYADYYFLEALLKYKSITDK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	64	390	1.7e-127	0.9878419452887538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.03e-12	44	390	3	339	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG1331	YyaL	1.20e-04	236	344	463	569	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK62765.1	6.21e-213	24	395	1	371
QNL40061.1	2.68e-185	1	393	1	391
QUT26394.1	1.54e-184	1	393	1	391
QRM99493.1	3.00e-184	1	393	1	391
QUT31753.1	3.00e-184	1	393	1	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	1.64e-118	3	393	2	391	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	9.07e-52	52	390	53	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	9.28e-52	52	390	54	390	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	1.30e-51	52	390	54	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	5.00e-51	52	390	54	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	9.76e-95	37	396	36	400	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8DR77	6.05e-53	21	390	24	388	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q8E372	5.08e-51	52	390	54	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9A0T3	7.29e-51	23	390	26	391	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q9RC92	9.50e-49	48	389	21	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000062	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000592_01344.