CAZyme Information: MGYG000000592_01551

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000000592_01551
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1040		117654.92	7.8251

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000592	2977283	MAG	Madagascar	Africa

• Gene Location: Start: 869; End: 3991 Strand: +

Full Sequence      

MNRFLLNVIAALVLSQGLAVAQSDLRLVGGNGLEFSPLAGATAKVNGNTVEVSTNGANSG
IRFYTDLDVSEYASLRFKLTNKRNSFLVMAVQIQDTIYNSNNNKQEKGAMSDRLLIFPNE
TREVVIPLPAKLPYPEIYNGFKGLRNTPYSIDEHYSYSVDLLSVKMIKINAFKHVAGADY
SISDLRFARGEKSKLAPWMTWDESRFFPFVDRYGQFKHKDWPGKTHSDEDLRKAREKEEE
YLRAHTGAGDWSRYGGWKNGPRFEATGHFRVQKVDGKWWMIDPDGYLFWSHGVVRVTTST
GITPLDGRKEYFEDLPEKGTKMGHFYETYDALLKPYYTVRGIRETYDYSSANAYRKYGED
YKNVFADLAHRRLRSWGLNTIANSSDKDICLMDRTVYTDRIEISSPIIEGTGGSWWKFMD
PFNDGFAESVRSQLVARKRQLDDPWCLGYFVDNEIKWGDTEYLASCTIMAPATQKAKIAM
VDWLKGRYQDIQRLNGAWKTSFSSWDALLENRNRVPASAKKDLKEFNVKIIEAYFSTVRR
VFKEVAPDVLYLGCRFSGSNADVLNIAAKYCDVLSYNIYRPDLYDFSLPEGIDKPVMIGE
FHFGAMDRGMFHPGLIYTRNQNERADMYYRYVKSAMEHPNVIGTHWHQFSDQACTGRFDG
ENYQVGFTDICDSPYYETVDKVREVGYEMYGIRSGRKNADAPVYVDATALGVYGKAGEVP
GHPYSRLDPEKYGIKGSMATKCLQSTGLYVAFSTDSKSLSLKWETSPLKVVGVNTGANAQ
KGLDLYIKRDGRWVFAAVGSPNMSGDCVHHERKVISSMPEGTKECLLYLPLFDSVESLEI
GVDPGSTITASPNPFAHKIVFLGSSITHGSAASRAGMSYVARYGRDNGLYCLNLGFSGQA
KLQEYWARVAADIDADAFVFDQFSNPSAKVINESFDRFVDIIREAHPETPLIFLQTIRRE
RRNFNEEADAYEAAKQKTGEAKVRARMKTDKNIYFIPSDGFLGDDSLGTADGTHPTDVGF
SRILEKMSPKLNKILKKYIR

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	60	690	5.8e-148	0.9846860643185299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14606	Lipase_GDSL_3	3.34e-54	857	1031	2	177	GDSL-like Lipase/Acylhydrolase family.
cd01844	SGNH_hydrolase_like_6	4.67e-40	858	1031	1	177	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
pfam14607	GxDLY	1.09e-37	703	848	2	146	N-terminus of Esterase_SGNH_hydro-type. This domain lies upstream of SGNH hydrolase, but its function is not known. There is a highly conserved GxDLY sequence-motif.
pfam13472	Lipase_GDSL_2	6.99e-12	861	1019	1	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	5.37e-07	859	1030	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53973.1	9.78e-258	33	694	26	685
AXP07840.1	6.29e-212	105	697	125	722
ASV75458.1	2.69e-161	110	696	102	684
QNN24957.1	5.93e-161	108	696	607	1213
AXP07838.1	9.70e-156	68	696	97	712

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z6P_A	4.06e-75	107	690	119	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
4BQ2_A	5.77e-75	139	697	133	750	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	1.48e-74	139	697	133	750	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4LHS_A	4.89e-74	700	1036	5	337	Crystalstructure of a putative GDSL-like lipase (BACOVA_00914) from Bacteroides ovatus ATCC 8483 at 1.40 A resolution [Bacteroides ovatus ATCC 8483]
6XJ9_A	2.39e-73	210	690	223	759	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	1.05e-85	68	693	291	952	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	5.52e-54	68	691	263	914	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000232	0.999106	0.000176	0.000157	0.000153	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000592_01551.