CAZyme Information: MGYG000000593_00854

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000000593_00854
• CAZy Family: GH28
• CAZyme Description: Polygalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295		32156.52	5.0569

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000593	1980733	MAG	Madagascar	Africa

• Gene Location: Start: 97; End: 984 Strand: +

Full Sequence      

MIFLSECENVSLAGFTVRNSPAWNIHPILCEHVDALCLSIEGPKNSHNTDGFDPESCGFV
RILGCQFSVGDDCIAIKSGKLGIEPELRPATHDVLISHCYMHDGHGAVVLGSEAAGGIKD
LTVSKCLFERTDRGLRVKTRRGRGKDAVNEGITFEHIRMDKVLTPFVVNSFYFCDKDGKT
DYVQSREALPVDDRTPGFGATTFCDIEATNCHAAAAYITGLPESKVTRLTFQDVHVTFAA
DAEPFVPAMACGVEPMVRQGIIAQNVKVLDLQNVSIEGQDGEELQLQNVDKVVRA

Enzyme Prediction     

No EC number prediction in MGYG000000593_00854.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	1	242	2.6e-56	0.6461538461538462

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.31e-65	1	290	240	529	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	1.47e-21	2	178	88	255	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03003	PLN03003	1.75e-19	7	192	146	318	Probable polygalacturonase At3g15720
PLN03010	PLN03010	3.06e-19	4	202	162	348	polygalacturonase
PLN02218	PLN02218	1.67e-15	8	181	201	363	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34431.1	7.31e-215	1	295	237	531
ATP54717.1	2.97e-214	1	295	237	531
QUC03565.1	1.46e-156	1	294	236	529
QOL31033.1	6.44e-137	1	292	235	526
QOL34309.1	6.44e-137	1	292	235	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	8.31e-25	6	144	197	335	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	1.31e-18	1	144	202	344	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	1.35e-14	1	186	333	514	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	5.54e-61	2	270	25	295	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
A7PZL3	1.74e-24	1	287	201	481	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P49063	1.20e-15	9	172	199	353	Exopolygalacturonase clone GBGA483 OS=Arabidopsis thaliana OX=3702 GN=At3g07850 PE=2 SV=2
O22818	4.71e-15	2	176	156	321	Probable polygalacturonase At2g43860 OS=Arabidopsis thaliana OX=3702 GN=At2g43860 PE=2 SV=1
P48978	1.02e-14	2	191	223	400	Polygalacturonase OS=Malus domestica OX=3750 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998219	0.001752	0.000045	0.000004	0.000002	0.000009

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000593_00854.