CAZyme Information: MGYG000000593_01034

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000000593_01034
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591		67212.77	4.8924

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000593	1980733	MAG	Madagascar	Africa

• Gene Location: Start: 13; End: 1788 Strand: +

Full Sequence      

MVGYAGETVNKLRVWAAEPVEEHFDLEAFNRGDYALADAERAEAEAISAILYPNDAGEHG
RLLRLKQEYLFVSAGIYSLLDTFEKEHGENWELLPQFVAIHTNDTHPAMCGPELMRILID
EKKLEWDDAWNIVTQVVSYTNHTILPEALEKWPIGTFSKLLPRVYQIIDEISRRWHESFD
TTQEGWQERLRQTAILWDGEIRMANLSVICSHSVNGVAKIHSDIIKNIVLKDFYALTPEK
FNNKTNGISHRRFFAEANPTYAKLVTEAIGDGWLKDAFELEKLKSFQNDSEFLKAVGASK
RANKERLAAYVKAETGLVIDPNTVFDVQVKRFHAYKRQLMNIMKVMDIYNRRIADPNFHV
TPTTFIFSGKAASSYTFAKETIRLINSVADVINNDARVNEVMKVCFIPNFRVSNAQLIYP
AAEISEQISTAGKEASGTSNMKLMMNGAITLGTLDGANIEIADLAGRENEAIFGLTAPEV
EQLWASNNYFAWDTLNGDRERLGRVMDELKDNTFAGLSGNFESIYNELMNNNDPDLVMAD
FRSYVDAWEKLTNSYGDQETWNRKALLNTASSGWFSSDRTIREYRDEIWHA

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	2	590	3.4e-202	0.8249258160237388

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14986	PRK14986	0.0	3	590	222	809	glycogen phosphorylase; Provisional
COG0058	GlgP	0.0	1	591	185	748	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	2	591	210	796	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	2	590	205	793	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	1	590	207	794	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33256.1	0.0	1	591	218	808
ATP53563.1	0.0	1	591	218	808
AZH69617.1	0.0	1	591	218	808
AEB07178.1	0.0	1	591	218	808
QWT17136.1	0.0	1	591	218	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GJ4_A	7.76e-164	3	589	221	814	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2FFR_A	7.99e-164	3	589	221	814	Crystallographicstudies on N-azido-beta-D-glucopyranosylamine, an inhibitor of glycogen phosphorylase: comparison with N-acetyl-beta-D-glucopyranosylamine [Oryctolagus cuniculus]
2GM9_A	7.99e-164	3	589	221	814	Structureof rabbit muscle glycogen phosphorylase in complex with thienopyrrole [Oryctolagus cuniculus],5MCB_A Glycogen phosphorylase in complex with chlorogenic acid. [Oryctolagus cuniculus],7ONF_A Chain A, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
7O8E_A	9.21e-164	3	589	226	819	ChainA, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
1C8L_A	1.30e-163	3	589	232	825	SynergisticInhibition Of Glycogen Phosphorylase A By A Potential Antidiabetic Drug And Caffeine [Oryctolagus cuniculus],1LWN_A Crystal structure of rabbit muscle glycogen phosphorylase a in complex with a potential hypoglycaemic drug at 2.0 A resolution [Oryctolagus cuniculus],1LWO_A Crystal structure of rabbit muscle glycogen phosphorylase a in complex with a potential hypoglycaemic drug at 2.0 A resolution [Oryctolagus cuniculus],2GPA_A Allosteric Inhibition Of Glycogen Phosphorylase A By A Potential Antidiabetic Drug [Oryctolagus cuniculus],3AMV_A Allosteric Inhibition Of Glycogen Phosphorylase A By A Potential Antidiabetic Drug [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39123	5.48e-181	1	589	215	792	Glycogen phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=glgP PE=2 SV=1
P73511	1.58e-169	1	589	237	824	Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgP PE=3 SV=1
Q9Z8N1	8.61e-169	3	591	227	814	Glycogen phosphorylase OS=Chlamydia pneumoniae OX=83558 GN=glgP PE=3 SV=1
O18751	1.27e-163	3	589	233	826	Glycogen phosphorylase, muscle form OS=Ovis aries OX=9940 GN=PYGM PE=2 SV=3
P11217	2.52e-163	3	589	233	826	Glycogen phosphorylase, muscle form OS=Homo sapiens OX=9606 GN=PYGM PE=1 SV=6

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000009	0.000014	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000593_01034.