CAZyme Information: MGYG000000596_00044

Basic Information

• Species: UBA1724 sp900548225
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; UBA1407; UBA1407; UBA1724; UBA1724 sp900548225
• CAZyme ID: MGYG000000596_00044
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
751		84425.59	6.2861

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000596	2231726	MAG	Madagascar	Africa

• Gene Location: Start: 45576; End: 47831 Strand: +

Full Sequence      

MTTTAQIGHVWQGKWIGSTIPETDHVSRVHEANLEGRGAPWLRQIFTYRKLPEKVFLYIS
APGWFCAYINGKRVGDRVLSPVIAQFNAHVAYVCHDVTAYLQEGENAMAVLLGNGWYNCQ
SPMSGQMEHSPWRNQPSALIQLETESGQILLHSDQTWRAAASHIVMNALRAGETQDTRRM
KEGVSLPNYDDSSFGYAEIMNPPPGELIPEDCEPCRIMERLKPVSCVFLGGGSCLYDFGT
SVTGWCEITTEGPSGATIVLQHGEKLTKDGLLDISEASVFVGGDIFQKDTYILNGRGPQC
LHPHFCYHGFRYVQVQCSGGAVVSSLEACFIHTDFDILGHFSTETNPVLNRLQEITRRSY
LCNYTGIPTDCPHREKNGWTGDQNLAYETGCYNFDIHRGMENFCRMLMAEQRPSGQLPCI
APTGIWGYNWGAGPAWDAFIFEAAEKTLLFTGKDTILRQHYDGMKKYLEYCRKWHDVDGL
VDFGLGDWAHFTPERMPSRKMTSTAFYYDNARRFSVMASYLGRQEDAKEYHQLAEIIRRA
FVAHYVTPDGDCENNSLTALATPLFFNMLDDCPDVKNNVLRHLLAILDQEEYKANVGILG
AKFVGRVLGEMSRYDDMVRFFTQPECPGWGNWVRRGATSLWERWDGRDSHIHVMFGDVSA
CVFRYIAGIRPLKPGFSSFLLNPAVACISVPSFKCTFRTPHGTIASQMSGDDGHRTYECE
VPEGTEARLSLFGRETIPLAPGHYSFPLGRS

Enzyme Prediction     

No EC number prediction in MGYG000000596_00044.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	232	731	2.6e-129	0.9861111111111112
CBM67	35	204	4.8e-26	0.9090909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.41e-82	339	666	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.04e-42	50	219	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	6.15e-22	229	332	3	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.09e-10	668	731	1	63	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44981.1	5.78e-160	4	749	22	759
AVM44977.1	1.76e-151	35	729	13	701
QNN24933.1	1.49e-146	34	731	347	1054
ADQ17462.1	1.44e-140	11	746	113	840
AKP52856.1	1.90e-140	11	731	139	861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	4.17e-96	11	683	145	851	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	9.99e-77	50	729	310	992	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	4.39e-73	57	746	149	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	4.78e-76	50	729	310	992	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	1.02e-72	34	731	179	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	2.35e-65	11	745	146	883	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	2.78e-59	11	751	149	898	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999746	0.000238	0.000032	0.000002	0.000001	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000596_00044.