CAZyme Information: MGYG000000596_01729

Basic Information

• Species: UBA1724 sp900548225
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; UBA1407; UBA1407; UBA1724; UBA1724 sp900548225
• CAZyme ID: MGYG000000596_01729
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494		56319.96	6.5063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000596	2231726	MAG	Madagascar	Africa

• Gene Location: Start: 14334; End: 15818 Strand: +

Full Sequence      

MKRAIALFALFLGCIGLFAQESTVERLERELAEARAENAALRGQVPYRYETPERAPGQEN
VLGLRVAPIRNVRAAFIGCGARGGLFLRILSNFPDRVTIKAAADLYQEKLDAIDRELKEK
GYPYEVFYTTDPDGWREICERDDIDMVFIATPPNLHLPIAVWAMEHGKHVAVEVPVVHNV
QEAWKLVDTAERTRRHCVMLENCIYGDYELAIKNMVDLGLFGETIHAEGGYLHNLEEYRF
DYDDKTNWRTERPTRERRVSGNSYPTHGLGPIAHWLGINRGDRMKTIVSAESADFTMRHA
VNMLFGPKGDIPEGHFRPDQNLSIITTEKGRTMMLYYSTVLRQPYSRSYRLNGTRGFAED
HSQHNQSAKTCQRRLAFEPDFHSDLPASKVNALLRRYRHPIYERFAAEAERFGGHGGMDA
VMIMRLVYCLNNGLPMDIDVYDGASWSSIAFASVKSVQLGGMPVEIPDFTRGDWKTLDGV
KYYYLDEEGEMKAY

Enzyme Prediction     

No EC number prediction in MGYG000000596_01729.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	69	476	2.5e-133	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.03e-24	70	427	2	325	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.78e-14	72	193	1	112	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	1.49e-05	143	228	64	149	putative oxidoreductase; Provisional
pfam03435	Sacchrp_dh_NADP	7.56e-04	77	192	4	114	Saccharopine dehydrogenase NADP binding domain. This family contains the NADP binding domain of saccharopine dehydrogenase. In some organisms this enzyme is found as a bifunctional polypeptide with lysine ketoglutarate reductase. The saccharopine dehydrogenase can also function as a saccharopine reductase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL06379.1	1.41e-125	49	482	35	461
CBK63904.1	3.17e-121	49	485	34	463
BBL01207.1	4.62e-121	49	482	36	462
BBL11909.1	6.53e-121	49	482	36	462
BBL09117.1	6.53e-121	49	482	36	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	3.64e-80	54	476	25	440	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	6.87e-51	70	475	19	432	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E18_A	2.14e-12	69	356	3	246	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
3E82_A	1.64e-09	72	251	8	169	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
5YA8_A	9.67e-09	135	252	67	181	Crystalstructure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with myo-inositol [Paracoccus laeviglucosivorans],5YA8_B Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with myo-inositol [Paracoccus laeviglucosivorans],5YA8_C Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with myo-inositol [Paracoccus laeviglucosivorans],5YA8_D Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with myo-inositol [Paracoccus laeviglucosivorans],5YAB_A Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity [Paracoccus laeviglucosivorans],5YAB_B Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity [Paracoccus laeviglucosivorans],5YAB_C Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity [Paracoccus laeviglucosivorans],5YAB_D Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity [Paracoccus laeviglucosivorans],5YAP_A Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with L-glucono-1,5-lactone [Paracoccus laeviglucosivorans],5YAP_B Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with L-glucono-1,5-lactone [Paracoccus laeviglucosivorans],5YAP_C Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with L-glucono-1,5-lactone [Paracoccus laeviglucosivorans],5YAP_D Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with L-glucono-1,5-lactone [Paracoccus laeviglucosivorans],5YAQ_A Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with scyllo-inosose [Paracoccus laeviglucosivorans],5YAQ_B Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with scyllo-inosose [Paracoccus laeviglucosivorans],5YAQ_C Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with scyllo-inosose [Paracoccus laeviglucosivorans],5YAQ_D Crystal structure of scyllo-inositol dehydrogenase with L-glucose dehydrogenase activity complexed with scyllo-inosose [Paracoccus laeviglucosivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7MWF4	5.09e-116	14	482	10	464	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2
Q5LGW9	5.90e-115	54	475	2	414	Alpha-N-acetylgalactosaminidase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0874 PE=3 SV=1
Q64XS1	1.18e-114	54	475	2	414	Glycosyl hydrolase family 109 protein 2 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0955 PE=3 SV=1
A6KX96	3.17e-112	37	484	26	469	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q89ZX8	1.12e-108	46	486	31	467	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001750	0.720888	0.276315	0.000302	0.000367	0.000360

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000596_01729.