CAZyme Information: MGYG000000596_01779

Basic Information

• Species: UBA1724 sp900548225
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; UBA1407; UBA1407; UBA1724; UBA1724 sp900548225
• CAZyme ID: MGYG000000596_01779
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
778		87734.31	7.381

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000596	2231726	MAG	Madagascar	Africa

• Gene Location: Start: 8071; End: 10407 Strand: +

Full Sequence      

MLTSWIWLPEAGHDRDAYARFRLALSTPAKRPVLRISAHSTFCVRLNGEVVQGSQFSDLD
GHPTYSDLPLSGAWRPGRNTIEIQVYVLGRDSLTTAVVPPGLWAEVRDGAKILARTDESW
ECALDTAYENGLGIPLSSQLGDIFYYDASPRRLDWRKPRILGCGCLNTPTPRPAAAPPLR
ERPAPVTQVVQAGELLRTEDNTGTAAKMIFNDLLRAHYVDKSFCTPGTEELQHHLWGQPI
PFMLAPENAMRFPFTWPAPRFTSNGWYLIVDLGDEQTGWLTVTLQAEKGTVLEIAHGEHL
TDGRVRTYLDGRNFADRVVCDGGLLHFTHRLRRVGARYLEMHVTNATKPPKVGYLGIVPV
MRDLPKPAKISCPDRLLERLDATAIRTLALCQHEHFEDCPWREQGLYPYDSRNQALFGFP
IWGNYPFVASCYKLMGDNWNDNAQTLQMTSPGRQALSIPIFGLVWVTALWELYLHSGDRE
LVRPMLPTVEKLIDAVLKKTLDTPQGVIYHPGKHKEIWNFCEWVPGLSGELGNEDPTDYN
TPYNLYLVETLNAAAKLADAFKMPLAGKSKAELKKEAARLANTCGELFWDDKKGLIRTNL
LDTTPFHEHVQILAIYNGAVKGDRLRRVSASLLNGGLVESTFSTLPYWIRTMRMLPKRFS
AQILPRLRRVFEPSILLGTKTLWETEAGGEDFTFAGSLCHGWSSTPAWYTRTGLLGIEPT
SPGYKTFRFRPDFQEDLEHFRGEVVTPHGTIEAEWRRMPNGSFEKQILRCPKETTPTP

Enzyme Prediction     

No EC number prediction in MGYG000000596_01779.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	263	766	1.2e-79	0.9642857142857143
CBM67	4	158	1.2e-18	0.8693181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.06e-11	370	707	6	333	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.95e-10	716	757	1	42	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	1.44e-05	269	342	9	85	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43288.1	4.92e-113	6	754	7	694
QNK57365.1	8.18e-102	5	761	9	759
ARN56684.1	8.28e-100	3	773	23	773
QGQ97405.1	9.21e-100	5	761	11	760
AUS95627.1	3.36e-97	3	709	11	703

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	2.33e-32	259	767	430	929	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	2.75e-11	332	711	169	539	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000596_01779.