CAZyme Information: MGYG000000599_00550

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000000599_00550
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	MGYG000000599_20|CGC1	54885.78	4.5513

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000599	2083618	MAG	Madagascar	Africa

• Gene Location: Start: 18114; End: 19547 Strand: +

Full Sequence      

MSVFPKDFLWGGATAANQFEGAWDVDGKGPSCMDMATNGNHHHPREITPVLDPDKLYPCH
DGVDFYHHYKEDIALLAEMGFKVFRFSMNWPRIFPTGFEDEPNEAGLAFYDRVMDECAKY
DIEPLVTLSHYEMPFAMCQKIDGWASREAIDCYVKYAKTVMEYYKGKCHYWLTFNEINCG
MMSLGNYMSLGILNPGSFDLRHQNDDPQKRLQALHHQFVASALAVKAGHEIDSDNKMGCM
IAYMLAYPLTPNPDDVELARERNQYRNYYCSDVMVRGEYPYFAPRLWDEEGVSLDITDED
RRILKEGTVDFYTHSYYQSQCASTDPAEETSGNLLGGAKNPYLKETAWEWPIDPMGLRIM
LNQVYERYQIPIMVVENGLGCCDEVNPDGSIDDDYRIEYLRDHIKAMAEAIKDGVEVWGY
TPWGCIDLVSNADGEMAKRYGFVYVDKHDDGTGTMERSRKKSFYWYKKVIETNGEEL

Enzyme Prediction     

No EC number prediction in MGYG000000599_00550.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	474	9.6e-149	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	477	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	477	1	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	4	477	6	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	476	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	3	477	5	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN32466.1	1.12e-235	1	477	1	478
SEU04537.1	5.45e-234	1	477	1	478
QOT69922.1	1.14e-233	2	477	4	480
QIH42235.1	1.22e-233	2	477	6	482
ANQ28096.1	1.87e-232	2	477	4	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	9.21e-186	4	477	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	3.77e-175	3	477	7	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4IPL_A	7.03e-170	1	477	17	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	2.06e-162	1	477	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	5.87e-162	1	477	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	2.07e-174	3	477	7	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q46130	3.38e-174	4	477	7	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	3.38e-173	4	477	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	4.94e-164	1	477	1	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P42973	8.29e-164	1	477	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000599_00550.