CAZyme Information: MGYG000000599_00800

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000000599_00800
• CAZy Family: GT26
• CAZyme Description: N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258	MGYG000000599_34|CGC1	29058.26	6.1545

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000599	2083618	MAG	Madagascar	Africa

• Gene Location: Start: 16249; End: 17025 Strand: +

Full Sequence      

MLKSYLNYPELNRVPVIDVPITGTNMSECVDFITHNIDDLHGEYICVSNAHTSVMAHDDP
NYWSCQAESVMSVPDGKPLSVVGRKSITSMGRVTGPDLMREIFSISAQHGWSHYFYGNEQ
KNLEALKESLQEEYPGLEIAGMEPSVFRPLSDGEKRDLSRRIADSGADFAWIALGAPRQE
VLMHELKGGPQPLMIGVGGAFNVLAGVVPEAPIWMQNLSLEWLYRLMQEPKRLFKRYLVT
NTKFLFYQFTGAKRKEGK

Enzyme Prediction     

No EC number prediction in MGYG000000599_00800.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT26	69	236	2.8e-50	0.9707602339181286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03808	Glyco_tran_WecB	1.97e-67	71	237	3	169	Glycosyl transferase WecB/TagA/CpsF family.
cd06533	Glyco_transf_WecG_TagA	1.67e-65	67	237	2	171	The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.
COG1922	WecG	1.23e-56	9	258	5	253	UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family [Cell wall/membrane/envelope biogenesis].
TIGR00696	wecG_tagA_cpsF	3.53e-41	69	241	6	176	bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family. The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK03692	PRK03692	2.54e-29	19	251	12	241	putative UDP-N-acetyl-D-mannosaminuronic acid transferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS68986.1	5.93e-94	13	246	8	243
AEU39273.1	2.40e-82	10	255	3	249
QSF40197.1	5.28e-78	2	251	13	266
CBL25528.1	2.05e-77	3	249	4	251
VCV23353.1	2.71e-77	10	246	2	237

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MPK_A	2.21e-29	11	232	1	221	ChainA, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7MPK_B Chain B, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7MPK_C Chain C, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_A Chain A, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_B Chain B, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_C Chain C, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9]
5WB4_A	1.62e-18	13	206	3	195	Crystalstructure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_B Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_C Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_D Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_E Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_F Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_G Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_H Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9]
5WFG_A	3.14e-18	13	206	3	195	Crystalstructure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_B Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_C Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_D Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_E Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_F Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6DHE2	5.52e-27	18	251	17	247	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=wecG PE=3 SV=1
Q8RKI7	6.85e-26	27	232	14	220	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarA PE=3 SV=1
A8G842	7.58e-26	25	251	22	244	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Serratia proteamaculans (strain 568) OX=399741 GN=wecG PE=3 SV=1
Q8Z397	5.66e-25	19	251	15	244	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Salmonella typhi OX=90370 GN=wecG PE=3 SV=1
B5EZ54	1.54e-24	19	251	15	244	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Salmonella agona (strain SL483) OX=454166 GN=wecG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000599_00800.