CAZyme Information: MGYG000000600_00381

Basic Information

• Species: CAG-791 sp000431495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-791; CAG-791 sp000431495
• CAZyme ID: MGYG000000600_00381
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
876	MGYG000000600_3|CGC3	100880.69	4.7558

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000600	2612842	MAG	Madagascar	Africa

• Gene Location: Start: 115118; End: 117748 Strand: -

Full Sequence      

MKQQILSSGWMLTIPEDNVYHIGPDPIPATIPGSVYSCLLENKLMPDPYWRDNELDALKL
MENDFLFTEHFVPDKEVLSSDRVILKFDGIDTIADITLNGTFLGHTENMHRSFEFDVKEL
LKEGENELVVKFFSPLKFCAASHEKIKNMESTDAVPGYPQLRKAHCMFGWDWGPRLPDAG
FYRPIRLLGVKKARLSDDIRVMQEHEIEETGVHGNVVKKVKLAVTAVTDPVCAEGVHTEI
TLTDPEGRTTCFASDENDEKCLGGKLTVENPKLWWPNGYGGQDLYTVTVRLMDDATGEEL
DQTQKRIGLRTVTVDTSPFPEEERDPHIGPQVREDRKEGRHFDFVVNGLRIFAMGGDYIP
EDNILQRVTRDRTEILIRDAAEAHYNCIRIWGGGYYLDDFFYDLCDEYGLLLWQDFMFAC
ASYELTEDFEENLKAEFTEVVRRLRHHASMSVWCGNNEMEAQVLEDHWNGEFNELIPGMG
GIRPVHHASNKQYYDYIKLYEYILPKIMKAEAPEAFYWPSSPSSGGNYEDIYEENIGDAH
YWGVWHGGDQFSDYRKHHFRFLSEFGFQSFPCMETVRSFTEPEDRNVFSEVMEMHQRNTA
ANGKIMNYLSATYRYPKNFDELLYCSQMLQLDAIRYGVEYFRRIRGTCMGTVVWQLNDIW
PVASWASIDYYGRWKALHYGEKRFFAPVSITCEEHGRLDQKPFVNSLPIPVEYSAALHVA
NETGETVRGTVRWQLRRPDSSVIREKEKDIEIAPYSGTWLDREIYNGLADEREMHLYYEF
VQDGKIVSSGSAMFVAPKHYRFADPKLSVRVEGDTVIVTSEGYAKGVCVESEDGNLRLSD
NFFDMEKGERVLTIVGKKPEGELRVRSVYDIAPVEA

Enzyme Prediction     

No EC number prediction in MGYG000000600_00381.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	763	4.1e-102	0.6901595744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.95e-99	1	688	10	632	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	8.87e-12	717	799	5	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	1.67e-11	804	870	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	3.04e-11	82	458	127	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	5.77e-09	197	310	4	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK00272.1	1.54e-314	1	871	1	815
AHF25065.1	8.36e-302	1	871	1	809
QTE69834.1	1.85e-298	1	871	1	810
QTE73768.1	1.85e-298	1	871	1	810
ADL35923.1	4.74e-297	29	868	23	820

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	2.72e-135	27	855	26	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.86e-135	27	855	28	818	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	2.94e-135	27	855	28	818	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	7.70e-135	27	855	26	816	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
6BYE_A	1.10e-134	1	858	3	835	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CGA8	3.73e-106	6	859	9	833	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q0CCA0	1.37e-104	3	860	6	832	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
A1D911	5.40e-104	1	859	4	833	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q4WAH4	1.50e-101	1	859	4	833	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	5.62e-101	1	859	4	833	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000600_00381.