CAZyme Information: MGYG000000600_00399

Basic Information

• Species: CAG-791 sp000431495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-791; CAG-791 sp000431495
• CAZyme ID: MGYG000000600_00399
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		36325.98	7.4708

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000600	2612842	MAG	Madagascar	Africa

• Gene Location: Start: 14821; End: 15780 Strand: +

Full Sequence      

MRVSIIIPVKEINDYIRTAMPHYARLEEKDFEILIFPDEPTEEAFPEMNGKVRIIPSGKT
GPAEKRDMALQYAQGEIIAFIDDDAYPAPQWLSRALPYFQDPSVGAVGGPAVTAPEDDDW
QKASGKVYESKLCSAGYTYRYLPEAKREVDDLPSVNLIVRAELFRKVGGYDSNYYPGEDT
KLCLDIVNSGHRIIYDPEILVYHHRRRMFRAHLKQATNYAKHRGYFAKVLPQTSRKFAYF
VPTLFVIGLIAGPILAAFFPFIWYIYAGVLLLYFVLLACSIHHAENFRVWILALAGIFLT
HVGYGIRFVQGLCSSQLLR

Enzyme Prediction     

No EC number prediction in MGYG000000600_00399.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	2	216	2.6e-18	0.9608695652173913

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02525	Succinoglycan_BP_ExoA	1.22e-33	2	246	1	249	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd04186	GT_2_like_c	2.09e-17	5	205	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1215	BcsA	9.78e-17	2	310	55	364	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	5.07e-14	2	215	3	223	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam00535	Glycos_transf_2	2.36e-13	4	164	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHB40045.1	1.34e-79	2	319	3	323
QWD09501.1	1.43e-78	1	318	13	331
QZP17290.1	1.83e-74	1	311	1	315
QAZ66370.1	8.11e-74	4	317	9	336
BAH77308.1	3.24e-73	4	317	9	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.68e-07	3	86	7	96	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0QSC1	1.86e-15	37	211	119	289	Pre-mycofactocin glycosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=mftF PE=3 SV=1
D4GYH3	1.64e-08	61	203	69	216	Glucosyl-dolichyl phosphate glucuronosyltransferase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglG PE=1 SV=1
D4GYH2	9.43e-06	61	215	76	219	Glycosyltransferase AglI OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
237	259
263	282
289	311