CAZyme Information: MGYG000000600_00645

Basic Information

• Species: CAG-791 sp000431495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-791; CAG-791 sp000431495
• CAZyme ID: MGYG000000600_00645
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316	MGYG000000600_6|CGC4	35876.79	5.467

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000600	2612842	MAG	Madagascar	Africa

• Gene Location: Start: 64052; End: 65002 Strand: +

Full Sequence      

MIIVEVKGGLGNQMQQYALYCKLRSLGKDVKLDLSWFDEDNQKNMLAPRSCELLKFRNLP
FEECTEEEKKALLGSSSFWGKAARKLHLGGKAAGKRFTESRMYHPEIFGLEDAYLDGYFA
CTKYYEDILGELRKVFVFPESAEPAVNAANQAVITEMEDAYTFSCAVHIRRGDYLDPENA
PLLGGICTESYYQGAIDFLERAVEAARSGRRIHFYVFSDDPGFAHACRFGNLGEEITVCD
WNKGEDSLLDMQLMMHCNGVIAANSTFSFWGGRLNAREPKILIRPLRHRNNQIPDPEAMR
DYWKGWTLVDTDGKAL

Enzyme Prediction     

No EC number prediction in MGYG000000600_00645.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	1	305	1.3e-49	0.9818840579710145

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	3.58e-55	1	284	1	250	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	1.33e-11	114	307	125	295	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11548	NodZ_like	3.56e-04	1	274	1	280	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ97415.1	1.41e-110	1	316	1	309
ADL35250.1	4.30e-97	1	316	1	309
SNX52916.1	1.27e-39	1	287	1	267
AOZ97425.1	2.69e-39	1	295	1	278
BAY51492.1	3.30e-37	1	309	1	293

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	2.76e-17	6	287	5	284	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000600_00645.