CAZyme Information: MGYG000000600_01543

Basic Information

• Species: CAG-791 sp000431495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-791; CAG-791 sp000431495
• CAZyme ID: MGYG000000600_01543
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	MGYG000000600_23|CGC1	46028.32	4.6707

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000600	2612842	MAG	Madagascar	Africa

• Gene Location: Start: 17668; End: 18852 Strand: +

Full Sequence      

MKKLNKMIKGVNLGNWLVLEKWMNPALFQGTTAEDEFNLPLQLPKEVYEARIRIHRSEYI
TERDFVQMKSLGLNTIRIPVPYFIFGDRPPFLGCIEELDKAFGWAERYDLQILIDLHTAP
DSQNGFDNGGVCGVCKFFQEPEEIEFVYTVLERLAERYGKRRGLFGIQILNEPISQKMWD
LMDLQKRYVPVDTRKAEGSRGYDPKELKEFYLTAYDRICPHLADGKYVVIHDGFDLFLWK
DFMQEERYSNVILDTHQYLMSAESMGCEQTLEGYQNFIREHFEKGIAEMSEYFPVVCGEW
CLFNSLACGRDTHGGQSVLNGEMEELQTVSDEEKKEIYRTLDRAQKKAWAAGSGYFYWSW
KLLIDTVSTDDWKGWDAWDLGRCAAFGWFEKEEA

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	55	361	1.4e-130	0.9933774834437086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	1.18e-19	8	175	18	193	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	8.64e-04	58	173	22	131	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT49144.1	3.16e-208	8	391	3	387
QCU02863.1	8.57e-207	8	389	3	385
ANU75476.1	1.05e-206	8	392	3	388
QQQ93046.1	1.05e-206	8	392	3	388
ASU28285.1	1.05e-206	8	392	3	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	4.36e-182	8	389	3	386	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	3.56e-181	8	389	3	386	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1EQP_A	2.19e-43	5	373	6	368	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
1CZ1_A	5.94e-43	5	373	6	368	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	6.72e-43	5	373	12	374	Exo-B-(1,3)-Glucanasefrom Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7Z9L3	2.29e-49	8	386	31	392	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
B8N151	2.29e-49	8	386	31	392	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q8NKF9	3.00e-44	5	372	34	399	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1
Q875R9	3.95e-44	6	389	46	424	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1
Q12628	6.42e-43	5	376	33	402	Glucan 1,3-beta-glucosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=KLLA0C05324g PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000600_01543.