CAZyme Information: MGYG000000600_02122

Basic Information

• Species: CAG-791 sp000431495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-791; CAG-791 sp000431495
• CAZyme ID: MGYG000000600_02122
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
700	MGYG000000600_45|CGC1	81147.65	5.4187

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000600	2612842	MAG	Madagascar	Africa

• Gene Location: Start: 7653; End: 9755 Strand: +

Full Sequence      

MLREQIKHHLVQIQDERYEKELLDKVDSYTNWYRLHKMELDRRMNETDHSEGEKLTREVI
RYSHLRNYLLSGVKFPDIIICCDDEGTLTDYAEKMICDYFAANPDINLVYGDEDRLSENS
QLKDAWLKSDWAPDTFLSTFYFGKVFAIRSSELFLINPGDRKATDYESKAKAKEDSREEA
NARQNDLDDSMRSWIYDKLCLKIAQADGGFTRRKNNRFPIGHIPEILFHSYRKGKPWDSN
LIKDSLTGRYSSESAEKRLISIIIPSKDNPEILGRCIHSIEKYADNSPYEIIVVDNGSSP
ENKEKVEKLLEEHNETGSARLLYQPMEFNFSAMCNLGASEANGELLLFLNDDIEIARPNW
LSYLSEKAKLPYVGCVGMKLLYPNSEIIQHAGVVNVKVGPIHKLQYCSNREEHYFGFNKG
VRNVIAVTGACLMIRNELFWEVGGFDAENFAVAFNDIDLCLKVFEKGYYNVVRNNMYLYH
HESLSRGDDREDKVKALRLSGEQERLLNRHPDLFRRDPYYHPYLEQDPAVTEFKIATEDA
LLQNPHYMDVELRKGRLKEAWEDPVLRLGVEYAGSLSVWLCGPMGRKDAKSREEDGYYIK
GYAFVIDADNAVYDRTLLFRKEEAPSSVWQIATERVYRPDIAEHLTDQKNDALTGFMTAF
RKDALKPGRYQIGMLAKDNTSRQRIVFWSDVYLTIPEQEA

Enzyme Prediction     

No EC number prediction in MGYG000000600_02122.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	261	443	3e-20	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	3.85e-33	262	482	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.47e-22	260	488	5	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	6.14e-16	261	439	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06423	CESA_like	6.88e-16	262	451	1	178	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd00761	Glyco_tranf_GTA_type	1.10e-15	262	377	1	112	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ95571.1	4.43e-146	78	688	89	694
ADL33298.1	1.28e-145	85	688	96	695
QNM02107.1	3.23e-118	2	694	3	666
AVK48684.1	6.22e-85	1	678	711	1344
QUF73846.1	6.22e-85	82	678	790	1344

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.73e-44	79	524	452	888	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	9.19e-37	85	524	411	831	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000021	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000600_02122.