CAZyme Information: MGYG000000601_01055

Basic Information

• Species: Mobilibacterium timonense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; Mobilibacterium; Mobilibacterium timonense
• CAZyme ID: MGYG000000601_01055
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
685		78754.04	5.96

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000601	1440391	MAG	Madagascar	Africa

• Gene Location: Start: 205; End: 2262 Strand: -

Full Sequence      

MAERTGETTEKETEKGEAYIIFTKAPKRGRVKTRMKPFYDDDQCLELQRALIRDGLRRAG
RLREKGVALFFAWSGEPSHLEELEAMAAEEGVVINFFSQRGEGLGERMDNAIRDVLGMEY
GSCVLTGTDSPHITCGDVMDAFWCLEERDLVFTPTEDGGYCLVGARRPCSEAFSLERYSH
GAVMEETLERIPGDLTWELLPETFDIDVPEDLERFRLLGENAPEDPCTGGSCTMEFTREC
PLISAIVPLYNEEEIAESVIRQCRKIRRPREIILVDGGSTDGTVERLRAALSDDDGIRII
SSPRGRGTQLNAGAEAAAGEILFFFHGDCQLPDDPAAEIKTVLKNHQWGCFGVRFDSRNF
FMYTNKWISNFRARRRHIVFGDQGIFIRKELFEKVGGFPDLRIMEDLQFSLNLKKIGFLP
GMAEHRILASDRRYRGSTVHKLLVMRNMARMRRMYMKGMDSYQGELEYERLCPDRRNWRE
KNKGYLFAKRTLDIVLGVVGLVILSPAMVITAVAVKVRGRGKVFYRQERIGYHGKPVVIW
KFRTMEEDAEEIESSLDPVQRREYREEYRLKEDPRVIPGGDFIRRWGLDELPQLVNVLQG
RLSIIGPRPILPEETEKYTDEELERLQSVRPGWMGYWQAYGRDWAGYHDGSRQRMELFYA
DNASLALDAKIFFKMFTAEAVRKMK

Enzyme Prediction     

No EC number prediction in MGYG000000601_01055.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	244	371	1.9e-20	0.7705882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR04283	glyco_like_mftF	8.03e-63	243	435	1	189	transferase 2, rSAM/selenodomain-associated. This enzyme may transfer a nucleotide, or it sugar moiety, as part of a biosynthetic pathway. Other proposed members of the pathway include another transferase (TIGR04282), a phosphoesterase, and a radical SAM enzyme (TIGR04167) whose C-terminal domain (pfam12345) frequently contains a selenocysteine. [Unknown function, Enzymes of unknown specificity]
pfam02397	Bac_transf	5.24e-62	489	681	1	179	Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.
TIGR03025	EPS_sugtrans	7.48e-60	484	681	253	438	exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase. Members of this family are generally found near other genes involved in the biosynthesis of a variety of exopolysaccharides. These proteins consist of two fused domains, an N-terminal hydrophobic domain of generally low conservation and a highly conserved C-terminal sugar transferase domain (pfam02397). Characterized and partially characterized members of this subfamily include Salmonella WbaP (originally RfbP), E. coli WcaJ, Methylobacillus EpsB, Xanthomonas GumD, Vibrio CpsA, Erwinia AmsG, Group B Streptococcus CpsE (originally CpsD), and Streptococcus suis Cps2E. Each of these is believed to act in transferring the sugar from, for instance, UDP-glucose or UDP-galactose, to a lipid carrier such as undecaprenyl phosphate as the first (priming) step in the synthesis of an oligosaccharide "block". This function is encoded in the C-terminal domain. The liposaccharide is believed to be subsequently transferred through a "flippase" function from the cytoplasmic to the periplasmic face of the inner membrane by the N-terminal domain. Certain closely related transferase enzymes, such as Sinorhizobium ExoY and Lactococcus EpsD, lack the N-terminal domain and are not found by this model.
TIGR03022	WbaP_sugtrans	4.64e-57	486	681	256	449	Undecaprenyl-phosphate galactose phosphotransferase, WbaP. The WbaP (formerly RfbP) protein has been characterized as the first enzyme in O-antigen biosynthesis in Salmonella typhimurium. The enzyme transfers galactose from UDP-galactose to a polyprenyl carrier (utilizing the highly conserved C-terminal sugar transferase domain, pfam02397) a reaction which takes place at the cytoplasmic face of the inner membrane. The N-terminal hydrophobic domain is then believed to facilitate the "flippase" function of transferring the liposaccharide unit from the cytoplasmic face to the periplasmic face of the inner membrane. This model includes the enterobacterial enzymes, where the function is presumed to be identical to the S. typhimurium enzyme as well as a somewhat broader group which are likely to catalyze the same or highly similar reactions based on a phylogenetic tree-building analysis of the broader sugar transferase family. Most of these genes are found within large operons dedicated to the production of complex exopolysaccharides such as the enterobacterial O-antigen. The most likely heterogeneity would be in the precise nature of the sugar molecule transferred.
TIGR04282	glyco_like_cofC	9.98e-55	20	212	2	189	transferase 1, rSAM/selenodomain-associated. Members of this protein family show strongly correlated phylogenetic distribution, and in most cases co-clustering, with an unusual radical SAM enzyme (TIGR04167) whose C-terminal pfam12345 domain often contains a selenocysteine residue. Other members of the conserved gene neighborhood include another putative glycosyltransferase, an alkylhydroperoxidase family protein (TIGR04169), and a phosphoesterase family protein (TIGR04168). The cassette is likely to be biosynthetic but its exact function is unknown. [Unknown function, Enzymes of unknown specificity]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK78105.1	3.53e-103	17	455	3	427
AVM48486.1	2.64e-101	18	469	13	448
SET56509.1	2.62e-99	18	463	4	436
QRP38681.1	3.46e-99	18	455	4	426
ASN96524.1	3.46e-99	18	455	4	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W7L_A	5.84e-21	487	683	9	186	Structureof Campylobacter concisus PglC I57M/Q175M variant [Campylobacter concisus 13826],5W7L_B Structure of Campylobacter concisus PglC I57M/Q175M variant [Campylobacter concisus 13826]
3CGX_A	8.26e-15	20	222	8	208	ChainA, Putative nucleotide-diphospho-sugar transferase [Oleidesulfovibrio alaskensis G20]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57491	7.39e-33	489	674	275	459	Uncharacterized sugar transferase HI_0872 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0872 PE=3 SV=1
P26406	1.95e-32	487	681	278	469	Undecaprenyl-phosphate galactose phosphotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbP PE=3 SV=2
P14186	1.18e-31	488	678	28	218	Exopolysaccharide production protein ExoY OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=exoY PE=3 SV=1
Q02731	1.04e-30	488	678	28	218	Exopolysaccharide production protein ExoY OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exoY PE=3 SV=1
Q46628	2.05e-28	487	674	279	465	UDP-galactose-lipid carrier transferase OS=Erwinia amylovora OX=552 GN=amsG PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
495	517