CAZyme Information: MGYG000000601_01155

Basic Information

• Species: Mobilibacterium timonense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; Mobilibacterium; Mobilibacterium timonense
• CAZyme ID: MGYG000000601_01155
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		44307.91	9.0649

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000601	1440391	MAG	Madagascar	Africa

• Gene Location: Start: 403; End: 1593 Strand: +

Full Sequence      

MNNKKNGGGRTGRRRSSRPAHYRHRRKGYFFDNMVYALRRFRNKVRRKLKKWWKEQRPRF
IVCVAGLILILILVIAHGLSGGSERISTDGFTHDSRFSNYLILNGIDVSYAQGDIDWKAV
KKSGVDYVIIRAGYTGGNTGKRYIDEYFASNIKEAEDAGLMTGIYWFSQATTTDEAKAEA
NELVKLAKDYEVDLPLVMDYELLDGGMLSEAFSSGSLTASGATDCALAFCQTVEKAGYDS
MVYGNSSFLQSNLDPVTIGENTHVWMAQYTTSASYSYLYSMWQASNTEKVSGITKNVDRD
FWYVDTGSGYNAYGADSSRKSMSKCTVEIKNSSTTYMGFKVEPKVSVYDGRKELEEGKDY
YLSYVQNTGPGTGYAVVTGMGDYKDMAFASFKIKGI

Enzyme Prediction     

No EC number prediction in MGYG000000601_01155.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	106	293	1.8e-46	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	3.95e-73	105	303	3	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	1.56e-37	105	300	2	184	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	5.54e-30	106	293	1	180	Glycosyl hydrolases family 25.
cd06525	GH25_Lyc-like	1.26e-27	104	301	1	183	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06524	GH25_YegX-like	8.96e-23	105	300	2	190	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASS37687.1	8.72e-109	40	394	11	387
AVM47472.1	4.95e-108	40	394	18	387
AVM48022.1	1.35e-51	54	383	13	338
ASS38209.1	2.64e-51	64	383	23	338
CBK79644.1	1.79e-46	89	361	125	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WWC_A	1.09e-15	106	303	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
2WW5_A	1.45e-15	106	303	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
4KRU_A	1.03e-11	103	298	20	203	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	1.33e-11	103	335	20	240	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
1JFX_A	1.79e-10	103	300	5	200	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	1.23e-10	94	321	2	218	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P34020	3.55e-10	103	300	1	178	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
P25310	2.23e-09	103	300	82	277	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999835	0.000174	0.000001	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
60	82