CAZyme Information: MGYG000000604_00489

Basic Information

• Species: UBA1829 sp900549415
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549415
• CAZyme ID: MGYG000000604_00489
• CAZy Family: GH10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489	MGYG000000604_3|CGC1	55479.83	6.2521

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000604	3604218	MAG	Madagascar	Africa

• Gene Location: Start: 15238; End: 16707 Strand: +

Full Sequence      

MFDISKFSSAMSQGYWMRWNEDVQNRIDRDIEANRKADGSFRIDGIPAGAEVKVEQQKSE
FIFGAHIFNFDQLGTDERNAKYKALYGTLFNSATIAFYWQTLEPEEGKPRFRAEYRDTAD
FWNRCPEPKLQPHWRRPAVDPVVDFCLSKGIRLHGHPLVWSSNRWQLPFWLFAKIPIDAL
AKANFKRNPVNGTLENDATHAVFGDMSAEEFADKYPEYAAELNAVVARRIMEIACRYGDK
IDSWDVVNESATDYGNGLMVPGSRICKAGCGPMPGDYTYRGFKIAESIFPARAKLNINDY
NMGDEYLNQTRDLLKRGCKIDIMGAQMHLFDPQQCLDIADGVSDNQSPASVTETFERLGK
AGLPIHLSEITITAPNNDERGQAIQAVMMHNLYRLWFSLKPMMGITWWNVVDDCGAPGEP
SVSGLFSRNMEPKPAYFAMNDLVNNAWKTRTCVKAGKNGEVEFRGFRGTYRLTWLDASGK
ECSKEVVLH

Enzyme Prediction     

No EC number prediction in MGYG000000604_00489.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	54	440	4.2e-48	0.976897689768977

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	2.81e-39	99	439	3	263	Glycosyl hydrolase family 10.
pfam00331	Glyco_hydro_10	1.60e-35	79	438	24	307	Glycosyl hydrolase family 10.
COG3693	XynA	2.86e-29	73	441	44	339	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47074.1	1.56e-245	5	489	12	494
AHF92621.1	1.41e-230	10	483	17	485
QQZ02681.1	9.21e-203	10	485	24	491
QGA28189.1	6.25e-193	10	479	27	494
AWI10666.1	5.20e-172	11	481	1	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FHE_A	1.76e-18	100	439	58	338	Highlyactive enzymes by automated modular backbone assembly and sequence design [synthetic construct]
3W24_A	2.68e-16	140	442	69	326	Thehigh-resolution crystal structure of TsXylA, intracellular xylanase from Thermoanaerobacterium saccharolyticum JW/SL-YS485 [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
3W27_A	1.58e-15	140	442	69	326	Thehigh-resolution crystal structure of TsXylA, intracellular xylanase from /Thermoanaerobacterium saccharolyticum JW/SL-YS485/: the complex of the E251A mutant with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3W28_A The high-resolution crystal structure of TsXylA, intracellular xylanase from /Thermoanaerobacterium saccharolyticum JW/SL-YS485/: the complex of the E251A mutant with xylotriose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3W29_A The high-resolution crystal structure of TsXylA, intracellular xylanase from /Thermoanaerobacterium saccharolyticum JW/SL-YS485/: the complex of the E251A mutant with xylotetraose [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
3W25_A	1.58e-15	140	442	69	326	Thehigh-resolution crystal structure of TsXylA, intracellular xylanase from /Thermoanaerobacterium saccharolyticum JW/SL-YS485/: the complex of the E146A mutant with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3W26_A The high-resolution crystal structure of TsXylA, intracellular xylanase from /Thermoanaerobacterium saccharolyticum JW/SL-YS485/: the complex of the E146A mutant with xylotriose [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
3RDK_A	1.66e-15	115	441	37	337	Proteincrystal structure of xylanase A1 of Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RDK_B Protein crystal structure of xylanase A1 of Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RO8_A Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RO8_B Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RO8_C Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RO8_D Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RO8_E Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RO8_F Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RO8_G Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],3RO8_H Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],4E4P_A Second native structure of Xylanase A1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2],4E4P_B Second native structure of Xylanase A1 from Paenibacillus sp. JDR-2 [Paenibacillus sp. JDR-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6CRV0	4.22e-14	115	441	550	850	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P36917	9.13e-14	140	441	418	674	Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynA PE=1 SV=1
O69230	6.33e-13	59	441	377	709	Endo-1,4-beta-xylanase C OS=Paenibacillus barcinonensis OX=198119 GN=xynC PE=1 SV=1
P38535	8.38e-13	140	441	270	526	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
I1S3C6	1.74e-12	140	444	141	381	Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYLD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000604_00489.