CAZyme Information: MGYG000000604_00817

Basic Information

• Species: UBA1829 sp900549415
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549415
• CAZyme ID: MGYG000000604_00817
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
746		81687.73	5.1539

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000604	3604218	MAG	Madagascar	Africa

• Gene Location: Start: 152710; End: 154950 Strand: +

Full Sequence      

MKYPYQNPALPVEERLDDLMKRLSTEEKIGQLCKPRAFCEFEKTAGGVALKEEYREFSRK
NPPGCVYGILRSDPWTKRNFQNGASGEDRERIVRLFDENAASRSVPVPLAKAEEAPHGLS
VLEATVFPCGLAIGASFDRELAYEIGRAIGRETLACSMNTVYAPVLDIASDPRWSRVEEC
YGEDPALVTELGESCFRGIQETGVLALLKHYIGGGASENGLNQQPAHMGTAELYNGPLRP
FRRCIAAGAKALMSTYHDVDGEPCTGSRYLLTDVLRGELGYRGFVTADGGAVERLYSLRL
ANSLPEAAARALKAGCDMESGHPSLAECGEMLRDALREGLISEADLDLAVRRVLRVKFEM
GWFDKSVTFDSSVLRSPAHRELALRAAHESIVMVKNNGVLPLKTRRIALTGPNAANAMNQ
LGDYTAFQRREAITTVFDALKAESGCELRFEQGCRIRSMNRIGFAAAVAAAEKSDCCIAV
LGGSSWHDAEETVDPVTGAVIGAEGDTAESTEKESGEGTDRASLNLCGVQLELLRELKKT
GKPLIAVLIEGRPLQVDEILELADAVLIAFYPGEAGGRAIADILTGRVSPSGRLPVSVPY
STGQLPVNYNTAVDRRNRFYLDSPAFPALEFGFGLSYTTFEYSSLIVEGRQVRVTVSNTG
SRAGGEVAQFYLTAHGDVMQRPWCELCHFERFFLEPGESRELRFALTDEMLYRYDCSGTL
RKEVRKFTVRAGGNLRDVLTVDCEIV

Enzyme Prediction     

No EC number prediction in MGYG000000604_00817.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	102	319	4.2e-64	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	5.78e-124	4	738	23	757	beta-glucosidase BglX.
COG1472	BglX	7.04e-85	23	448	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	4.53e-66	24	356	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	5.29e-65	3	704	40	740	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	5.09e-50	391	637	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ34746.1	1.16e-180	5	746	3	763
AZN43554.1	6.15e-178	5	739	3	759
AIQ22895.1	1.88e-176	5	746	3	763
ANY75287.1	9.55e-173	5	711	3	730
AYB43197.1	1.74e-172	5	711	3	727

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	2.00e-100	5	732	36	771	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	2.16e-94	5	738	7	748	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	3.01e-94	5	738	7	748	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z9S_A	4.35e-92	4	706	16	746	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
5XXL_A	7.96e-90	6	738	4	744	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.57e-96	90	745	48	722	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	1.29e-89	5	732	24	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	5.03e-85	5	746	24	765	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	1.56e-80	5	711	29	720	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	6.78e-69	7	739	26	769	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999916	0.000081	0.000013	0.000001	0.000000	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000604_00817.