CAZyme Information: MGYG000000604_01205

Basic Information

• Species: UBA1829 sp900549415
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549415
• CAZyme ID: MGYG000000604_01205
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552	MGYG000000604_6|CGC1	62308.3	9.682

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000604	3604218	MAG	Madagascar	Africa

• Gene Location: Start: 169701; End: 171359 Strand: +

Full Sequence      

MKKTVLCFLLLAALLYILPLGLREMFSPDETRYAEIGREMAVSGDWVTPRLNGVLYFEKP
ILGYWLFAASEKFFGENAFAVRLPCALATLLSALVIFFLTRRFSGLGEKAGLLASGFFLL
TPIVFGLGVVATLDPVFSFFLTLAMALFYFAVQAAGWRRAGWLFLFGLAAGAAFLTKGFL
AFVLPGLSIFGWLCWTRRWKEMLTLPWIPLIAVLLIVLPWAVMIHQAQPDYWSYFIYDEH
IKRFFEKEQHPEPFWFFVPVLVGGLGWFLLLLPAALRGYAKKIPQDDFTRYLLCWTFLPF
LFLSMSTGKLATYILPCFAPLAILFATGLTRSLADRKLFRIADVLLLAFAVLLPVAAVGL
AAIQLSGVKWAPFAVGEGWKWGALTLAGLLLSVLLFFAVKEKNGWNKLALFGFGLCPVLF
MMHIAIPDVFLNRKTPCPLLEKVKKEISPETKLMSYRHPFQAVNWVFRSSDVYMYRVAGE
ISWGLDHDPEMKARRLLDVAATNRLIEENRGRGGVLLVLPTKVYLEDAHLLPEPEWVKAN
TAHHKGYTVVKF

Enzyme Prediction     

No EC number prediction in MGYG000000604_01205.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	497	1.2e-119	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	1.74e-116	21	534	24	536	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	8.96e-61	27	338	32	345	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	8.21e-25	32	235	34	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	3.44e-21	59	220	2	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG4346	COG4346	1.04e-06	57	220	134	293	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH42096.1	1.08e-119	2	536	3	537
QSH42095.1	1.73e-117	1	494	1	501
BCL61706.1	2.69e-111	1	552	1	554
CBX27700.1	1.97e-109	2	552	6	560
AVM46371.1	2.27e-102	14	494	15	507

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.99e-30	5	331	34	366	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5BDQ8	2.56e-94	11	519	13	519	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
A8FRR0	1.30e-92	14	488	18	488	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
B2VBI7	2.21e-92	1	550	1	546	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
C6DAW3	3.55e-87	1	538	8	541	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1
B7LM74	2.39e-86	3	550	5	545	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=arnT PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.469562	0.526340	0.001496	0.000650	0.000757	0.001170

TMHMM  Annotations     

start	end
5	27
47	69
78	100
110	129
136	158
173	195
202	224
254	276
288	305
310	332
344	366
381	399
404	426