CAZyme Information: MGYG000000604_01359

Basic Information

• Species: UBA1829 sp900549415
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549415
• CAZyme ID: MGYG000000604_01359
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
796	MGYG000000604_7|CGC1	89497.21	5.1926

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000604	3604218	MAG	Madagascar	Africa

• Gene Location: Start: 173097; End: 175487 Strand: -

Full Sequence      

MNPNAYWIWPAKTLYLQNCYAGFRHDFNMEKLPSAAPLDITADQSYRLYVNGRYICRGPV
RGYQDNWPYDRVELLPYLKTGHNWISVEAYNPGISTFAYNHADSAGFLCSAEWDNGTLIL
SQVEGWTIFRNTAYAHDTGRLSFQMGWQEEVDLTFDDRSWITAEAGFRIPPQPKWCAPGQ
HAQGSLPWSGLETRRIPMLDEHEQAPAGLVSFAAGPCSTPAKTFPFPEHNIAWDFAENEL
PALEYGPLPPCRREGNALCFEIPEAGKGKVSCITVDLGADEWLPGTPVFDYEDAEAGMIV
DFFYFHWLQDGKIQFRPEPGAGSELAMASRVHLGAEKGHCELNQIMGVRHVTLAVRENTR
PLKIRLSWRSAVYPMQITGNFHCSDKVLNDIYRICRHTQQVCSLDAFVDTPWREQSQWWG
DARVQAKNTHFLTADPSLLRQGIHSIAGQHAPGNLTFADAPTTDCGCVLPDFCLTWIATL
YDLWFQTGSTEHLDEQKSRAEDIFAYFEGTRGPDGLLQADPRYWLFEDWCDLPKNATPTF
LNLWHLYTETLYCKLLHHAGCEADAQELEVKITAERKLLADAFFDPEQGLFVPEIGKDGK
QNGVPSVHDQVLALLLNLRPEAKDSMIEKRILPCLKGTLSGCAEPGSFWSTYLLDAAQMY
GLRAEALKYIRREWAKMVPTGTAWETFGKGDYSGWSYSHAWSAHPLSHLPELVFGVKQTE
DAWRRVEFAPLLSALDSADLVLPTPQGTIRASLKRSGNTAELNFQIPAEICAQILLPGET
IRTTGEAAVISRKLSV

Enzyme Prediction     

No EC number prediction in MGYG000000604_01359.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	285	774	6.4e-74	0.9583333333333334
CBM67	5	165	3.1e-26	0.9431818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.86e-13	378	703	3	330	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.91e-08	715	780	1	67	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAM04878.1	1.34e-156	5	778	16	781
QYM78626.1	6.14e-155	5	778	18	767
SDU02729.1	1.15e-154	5	778	16	774
QYY35421.1	2.77e-148	5	779	17	770
SDT92885.1	6.82e-145	3	778	8	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.65e-42	2	777	5	942	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000604_01359.