CAZyme Information: MGYG000000604_01536

Basic Information

• Species: UBA1829 sp900549415
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549415
• CAZyme ID: MGYG000000604_01536
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424		49911.91	7.0044

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000604	3604218	MAG	Madagascar	Africa

• Gene Location: Start: 25695; End: 26969 Strand: +

Full Sequence      

MLGIFSMAPVSFPPDFIWGSATAGYQIEGDNIHCGHWHREVLYHAKEPSGKACNFWNLWP
QDFAMLSELGHRMFRMSVEWSRIEPEEKRHDEEALARYLAMFKELKKRGIKLCLTLHHFS
QPQWFEEKGEFNDAENIGCFLRHLEYLVPKVAPYVDLWNIFNEFNNGDSPSLYGRKTNCL
IAHARAAQIIRAYSKAPVSTAHAMTCYQPLDSDDEFDVTRTRIRDWVVNRFFYHAVRTGE
ILFPYRDAVEVPELKGSCDFWAINYYTRHFVSARKAVSSRHECQRIRPIDRDFYLEEFYP
QGLVDGLCQLKDLPVYITENGFCCDDDRLRILYLARHLQAVSEAMRKGCDVRGYLYWSLL
DNYEWGSFVPRFGMADVDFKTFERTPKPSAYFFRDILSRGGFDRDLVLKYLPEFKDWKIY
PSKK

Enzyme Prediction     

No EC number prediction in MGYG000000604_01536.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	11	399	3.3e-97	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.96e-85	12	406	4	459	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	5.28e-71	8	402	1	453	Glycosyl hydrolase family 1.
PRK13511	PRK13511	2.09e-53	11	396	4	462	6-phospho-beta-galactosidase; Provisional
PLN02814	PLN02814	5.79e-33	11	398	27	481	beta-glucosidase
PLN02998	PLN02998	1.02e-31	12	397	31	485	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADW18818.1	4.39e-151	1	411	1	426
AVM43515.1	1.80e-146	1	419	1	419
ADQ08048.1	2.04e-122	1	423	1	432
QCX34294.1	5.35e-116	1	413	1	420
QNM13665.1	1.22e-109	1	416	1	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VFF_A	7.33e-70	9	415	2	422	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
6Z1H_A	1.11e-62	10	403	9	451	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
6IER_A	1.39e-52	8	406	28	436	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
4HZ6_A	3.62e-52	12	403	5	443	crystalstructure of BglB [uncultured bacterium],4HZ7_A Crystal structure of BglB with glucose [uncultured bacterium],4HZ8_A Crystal structure of BglB with natural substrate [uncultured bacterium]
3CMJ_A	5.64e-52	12	403	26	464	ChainA, Beta-glucosidase [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2RGE8	2.36e-51	11	396	4	461	6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) OX=160491 GN=lacG PE=3 SV=1
Q8NZE1	3.29e-51	11	396	4	461	6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=lacG PE=3 SV=1
Q5X9Y7	6.40e-51	11	396	4	461	6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=lacG PE=3 SV=1
Q1JEZ3	8.93e-51	11	396	4	461	6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) OX=370552 GN=lacG PE=3 SV=1
Q48RC8	8.93e-51	11	396	4	461	6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) OX=319701 GN=lacG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.992495	0.007461	0.000049	0.000010	0.000007	0.000012

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000604_01536.