CAZyme Information: MGYG000000604_01644

Basic Information

• Species: UBA1829 sp900549415
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549415
• CAZyme ID: MGYG000000604_01644
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	MGYG000000604_10|CGC1	43642.57	10.0593

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000604	3604218	MAG	Madagascar	Africa

• Gene Location: Start: 11686; End: 12855 Strand: +

Full Sequence      

MNRGRKEIWILAGEASGDLYGARIASEIRRRRPDVVVCGMGGVEMRKAGVELLVDSSELG
VIGLIEVLENIFKFIRIFLYLIREAKKRRPLEVILIDYPGFNIRFAKAMWKAGIPVVWYI
SPQVWVWRRGNIRKLAKYCRKLMVIFPFEPEVYEGSGLDVEFVGHPLVDIVKGRADATIE
RDPNTVLLLPGSRKKEIEFLLEPFLKTAAILKSRNPKLQFVVASPRERILQMVRDGIQAF
MTKHPDYPLPKIELTRGKTAFWMQRCTAGLAASGTVTVECAIAGIPLVVAYRLNQITFLL
ARLIIGRLFRGFFTMPNIILNRCAFEEFLQFQVVPEDLADAMERILPGGSRRAQVEQDMN
DVVVQLSGGASGAIVKAAACALSAIPAEK

Enzyme Prediction     

No EC number prediction in MGYG000000604_01644.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	8	363	4.2e-106	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.86e-119	8	389	4	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.59e-109	6	374	2	370	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.33e-87	8	366	1	358	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.87e-76	1	366	1	369	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.56e-46	53	344	42	315	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH40861.1	4.92e-147	1	378	1	379
AVM45461.1	1.40e-128	5	373	11	380
QHI67954.1	2.82e-72	5	369	2	361
ADW17729.1	8.03e-72	6	385	9	387
QQG66459.1	8.49e-72	6	383	14	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.56e-42	8	349	9	348	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.03e-42	8	349	9	348	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	6.44e-67	6	369	7	366	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q2LVL8	1.28e-66	6	385	4	378	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1INL4	2.96e-64	7	369	3	360	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1
B8JE78	6.03e-64	7	378	10	375	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
A9NCA7	1.39e-63	6	369	4	360	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000604_01644.