CAZyme Information: MGYG000000604_01705

Basic Information

• Species: UBA1829 sp900549415
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549415
• CAZyme ID: MGYG000000604_01705
• CAZy Family: GH151
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677		75721.53	6.0907

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000604	3604218	MAG	Madagascar	Africa

• Gene Location: Start: 76137; End: 78170 Strand: +

Full Sequence      

MNEEKTCYSRLLIDNHITDLKNSYMRKFSPEEYVRMVRLSGVESAMVYACDHNGNCYYPT
QAGHIHANLDGRDIFGETVAGLRKAGIVPVAYYTVNYHNDCARRLPHTRVIDNVGMDHDG
RYHFTCPNQPDALAFYEKQIAEILQYDVDGIFIDMTFWPTICCCSACREKYGKPFPEVID
WDSPEWVGFQRFRERSLAEFARNLTDFVRRTKPGIAVTHQFSPVLHGWYLGQSDGIAAAS
DYASGDFYGGKTQQRFAVKAFAAYTRIPPFEFMTSRCVSLNDHTSAKSDEELFLSALTTL
ANGGAYLFIDAINPDGTLEETFYRRFHDLNRRLEPFRNAVRNLNGHSAASVGVYFSMASC
VNRAINGIELKKFNGGRANNMSVRKNAVLDEMLGMTEVLNRLHTPWKVVTSSTADFTGLE
TLIVCNAAYLAPEETGRLREFVRNGGTLIATGATSLYDTEGCGGKNFALADVFGVDYTGK
RSDSVTYTGTELIYAEGNVPLARPVPETEVRGTLTFPDFPVNDPERYASIHSNPPGEKTD
FPALTFHRFGKGVCVWLAAPVALQNHATQRTFMKDLLREFLPSFVVQEKNLAESAEITLL
KGADGTELLCIVNRQDEAPVIPLCNVEFSIRHSGRPKRIVRVSDGAEIPVAWENGELHFS
IPELHCGEFFRLEGGVE

Enzyme Prediction     

No EC number prediction in MGYG000000604_01705.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH151	30	155	3.4e-27	0.9847328244274809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14871	GHL6	5.87e-12	29	155	1	135	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.
COG1874	GanA	1.23e-08	119	451	117	490	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam08532	Glyco_hydro_42M	1.53e-06	399	579	39	203	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
cd03143	A4_beta-galactosidase_middle_domain	2.98e-06	413	484	48	119	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
pfam14258	DUF4350	0.002	393	449	8	66	Domain of unknown function (DUF4350). This domain family is found in bacteria, archaea and eukaryotes, and is approximately 70 amino acids in length.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44410.1	4.79e-269	7	673	16	686
QNK60153.1	5.95e-103	5	673	7	691
BBD45930.1	5.23e-97	5	664	10	685
BBH23071.1	4.39e-91	8	673	7	676
QTH44200.1	1.20e-38	13	672	17	674

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000604_01705.