CAZyme Information: MGYG000000604_02325

Basic Information

• Species: UBA1829 sp900549415
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549415
• CAZyme ID: MGYG000000604_02325
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
737	MGYG000000604_17|CGC1	83069.76	6.6116

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000604	3604218	MAG	Madagascar	Africa

• Gene Location: Start: 21186; End: 23399 Strand: -

Full Sequence      

MKKWNGVWINTGKTMLTPSPEVGRAPYLRKTFSCSSNPRKATVSLCGLGWHELYVNGKKA
DDRVLAPAVTQYDKRVSYIDYDVTGLLKPGKNAVAVLLGNGWYNCHTAEVWSFDKAPWRD
WPKLICDIFIDGQLAAKSDSSWKFHDSPVTFDALRNGEHYDARLEIPGFADADFDDSAWQ
NAVQCPPPGGLLCEEDELPCRIMKEYRPVKETFIFAHQTVYDFGTNLTGWCEIQVRGSAG
DRVILEHAEQVYPNGNICQELNSACIKKDGFQMDIYTLKGEGLETFHPHFTYHGFRYARV
QFDFPSGNKPQIASIKAQFIHNDFPSAGSFESSDETLNRLQQITRQTYLCNFTGIPTDCP
HREKNGWTGDAQLACETGLWNFNSKSGYLHFLRILADAQRPNGQLPGIAPTGGWGYNKAN
GPAWDSMLFEGVWQLYLFYGDAEPARELYGNMKRYISYCEMQANENLVGFGLGDWCHPDM
LRTAPAELTSSGFYYQDTLRLAKFAGLFGKLDDARHYAALAEAIRQSFNRKFYKGNGIYA
DGCMTSLATPLYFGLAEQDHALTAQRLAETVEANGGRIDFGILGAKFVPRVLAEYGYAET
AFELITQPEFPGWGFWVKSGATTLWEHWNGMYSQNHIMFGDISAWMFRYPAGAAPAFDAP
GFRRFTVKPCFIPQLNHVRMTHNTPYGELRIAWERTRGGIRGHIQIPDGCSAELHLPGQV
QQNIRKPFQFSLAETSF

Enzyme Prediction     

No EC number prediction in MGYG000000604_02325.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	217	716	1.2e-150	0.9861111111111112
CBM67	8	189	2.6e-33	0.9602272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.24e-109	325	649	1	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	8.75e-54	38	204	3	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.72e-25	219	321	8	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.80e-17	658	719	5	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK13272	treA	0.004	515	574	367	433	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44981.1	9.95e-227	2	714	27	749
AVM44977.1	1.18e-220	21	721	13	706
AHF16194.1	2.39e-192	4	718	137	863
QNN24933.1	2.26e-189	25	717	352	1055
QGQ94103.1	8.73e-188	2	734	121	862

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	7.62e-143	22	717	173	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	3.99e-88	29	719	135	849	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	4.39e-88	19	717	296	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.35e-95	25	716	184	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	2.02e-87	19	717	296	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.09e-86	3	725	152	887	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.58e-80	4	717	146	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000604_02325.