CAZyme Information: MGYG000000604_02460

Basic Information

• Species: UBA1829 sp900549415
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549415
• CAZyme ID: MGYG000000604_02460
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491		56569.55	9.1165

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000604	3604218	MAG	Madagascar	Africa

• Gene Location: Start: 35680; End: 37155 Strand: -

Full Sequence      

MKTHLLVIVSFLAALLSAAEPEILWELTAEKLPVLQLPQGAELLSGNILKVRGPAQPFAP
VDASLLRGRSVTVECMVRGEKLGQGALDCLRLAPNYLPSDKFRENWGYRPMRPVPAEKTD
WVRWHGTWHIPDYAGNFNLVFAHAGKDGTAEYRDVRILNIPLPEKAKPAGFNPAEHRTRY
RGAVVGRLRTEEDFRVFAEEFGGNLMRWQFLHGGPAEFESPEQYLEWGRARIRELQEKLP
WFRKYNIRFVIDLHRGAGQVNAINNNLGLWDKARQEAMIQLWREIAQAFKDEPLVYGYDL
LNEPGDKNYDVRSGALDRERLYETIAKEVRKIDSKTPIIVQNSYQLVPLAVPNVIYSPHT
YEPGEYTHQGVIGNGRSGSAYPDPAKGWNREFLKRMVQPLREFQLKYNVKIYVGEFGCVA
WAKGAEQWFKDWISIYEEYGWDWTYHAYREALLWSVEHAGPSRREMKPAPDTPRKQVILN
ALKRNRENNAK

Enzyme Prediction     

No EC number prediction in MGYG000000604_02460.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	185	449	1.3e-36	0.7381818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.49e-16	241	446	73	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	5.44e-07	235	458	118	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45191.1	1.14e-116	40	487	51	505
AVM45735.1	4.20e-96	37	487	48	510
AVM43793.1	1.86e-86	58	485	71	506
AVM44368.1	2.10e-85	60	485	86	521
AVM47005.1	4.39e-74	1	485	64	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NCO_A	9.16e-12	278	445	119	292	Crystalstructure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1],3NCO_B Crystal structure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1]
3RJX_A	9.16e-12	278	445	119	292	CrystalStructure of Hyperthermophilic Endo-Beta-1,4-glucanase [Fervidobacterium nodosum Rt17-B1]
3RJY_A	9.16e-12	278	445	119	292	CrystalStructure of Hyperthermophilic Endo-beta-1,4-glucanase in complex with substrate [Fervidobacterium nodosum Rt17-B1]
3AMC_A	2.20e-10	275	445	108	285	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AMG_A	1.26e-09	275	445	108	285	Crystalstructures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16169	1.38e-08	225	440	64	285	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P14250	1.00e-06	235	370	383	521	Endoglucanase 3 OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) OX=59374 GN=cel-3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000257	0.999130	0.000171	0.000142	0.000135	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000604_02460.