CAZyme Information: MGYG000000606_00106

Basic Information

• Species: RC9 sp000433355
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000433355
• CAZyme ID: MGYG000000606_00106
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642	MGYG000000606_1|CGC3	71498.22	6.6201

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000606	3291011	MAG	Madagascar	Africa

• Gene Location: Start: 121433; End: 123361 Strand: -

Full Sequence      

MKNNLSVRAFVLSTLFAIFACSICAGGNIGRAKTAELKVKSVKINGYVGGRIDDCISHRV
MEQDVDALVEPFRHRTETWRWQSEFWGKWTLGAIETYRYTGNAALYEKIAASVGQIIETQ
SPDGYIGNYAPEAQLKDWDIWGRKYTMLGLLSWYELSGDTRALSAASRVADHLISQLKSK
NAKIVKCGLYRGMASSSVLEPVMKLYNISGDKRYLDFATDIVSQWESPDGPKLVSRSDIP
VALRFPHPDTKWFSYENGAKAYEMMSCYEGLLEYYKVTGNEAYYEAVRKSVSHIIEEEIN
IAGSGSSIECWYGGRALQTVPTYHTMETCVGFTWMQLCSRLLKFCGDSRYADQIEKTFYN
AILGSMKCDGSQIAKYTPLEGWRVEGEKQCHMNINCCNANGPRAFAMIPALAYLTEGDCL
KINHYGDSEAEISLDKRNSMSIKVCGNYPVSGNISIELSPAKPAEFTLALRIPQWSKTTT
AKLISGSDTLNISLDNLPAGEYAKVDRKWKKGDCIELSLDLTPHLLELNGHQAVVRGPIV
LARDSRFNDGFVDECVVIQSSEDGSVALTPAEGNDFAWMSFTAPMVAGADLEGNGKPRQI
HLCDFASAGNTWDKSTRYKVWLPKTLNVTKGEYRAYNDAPHN

Enzyme Prediction     

No EC number prediction in MGYG000000606_00106.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	74	541	1.3e-56	0.9122137404580153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	9.16e-58	56	542	16	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	8.41e-57	30	557	5	515	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	1.22e-05	85	224	411	566	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04791	LanC_SerThrkinase	0.006	148	289	93	229	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	7.62e-202	39	641	24	625
AXC10260.1	8.42e-40	31	544	86	600
QHS51661.1	1.82e-39	88	544	123	582
AZO69015.1	2.80e-39	37	550	16	576
ADH61394.1	1.79e-37	28	548	3	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	1.42e-30	149	548	151	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.33e-24	36	540	10	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	2.68e-24	145	545	196	610	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	9.30e-23	36	540	10	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.019588	0.137669	0.841220	0.000718	0.000458	0.000339

TMHMM  Annotations     

start	end
7	29