CAZyme Information: MGYG000000606_00865

Basic Information

• Species: RC9 sp000433355
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000433355
• CAZyme ID: MGYG000000606_00865
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
923	MGYG000000606_3|CGC5	102264.79	5.4464

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000606	3291011	MAG	Madagascar	Africa

• Gene Location: Start: 214368; End: 217139 Strand: +

Full Sequence      

MKRLLLATIVMYLILPMAAQERFGEGSIYHNGWIDFNKNGIKDVYEDPTADINSRVEDLL
SRMNLEEKTCQMVTLYGYQRVLYDELPTPKWKEKLWKDGIGAIDEHLNGFRNWGLPLTDS
EWLWPASKHAKALNIVQRFFIEETRLGIPVDFTNEGIRGVEAYRATNFPTQLGIGHTWDK
ELVHEIGRITGREARLLGYTNVYAPILDVGRDQRWGRYEEVYGESPYLVAELGVQMASGM
QTDYQVAATGKHFVAYSNNKGGREGMARVDPQMAPHEVENIHIYPWREVIGRTGLLGVMS
SYNDYDGIPVQGSQYWLTDRLRNDLGFKGYVVSDSDAVEYLHSKHHVSANMKESVRQAVE
AGLNVRCTFRTPDSYVLPLRELVKEGTLPMSVIDERVRDILRVKFLVGLFDHPYQNDYEA
ADREVDGPANNEVALRASRESIVLLKNEGNLLPLDKDKIRTLAVVGPNADEVSFAQTHYG
PLATASVSVRKGLEEALKGKGRILYAKGCELVDENWPDSEIFPSKPTKEELRQMNDAVKL
ARKADAVIAVLGGGQRTSGENKSRTSLDLPGHQELLLKKLAATGKPVVLVLINGRPLSIN
WADEHIPAILEAWYPGSHGGTAVADVILGDYNPGGKLTVTFPRTVGQIPFNFPCKPNSQV
DGGNGVGPQGRQSRVHGALYDFGYGLSYTTFEYSSLKLSSKTISPSDSVEVSFTLRNTGS
RKGDEVVQLYIRDVLSSITVYEKVLRGFERVSLEPGESKEVSFTLAPKDLGLLDVDFRRI
VEPGEFEIMIGASSKDIRLSEKLLVDDGGDTAHVTYPDDASYVKTTFPAKIGVSEDATVS
VAEGKMIGSLGINWGAGTDCSFEILWTNGGGQFLPVYRGQVSTADKTERQVYTFESVGAS
EIRVAVTKGSATIISLESDVIKL

Enzyme Prediction     

EC	3.2.1.37	3.2.1.55	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	142	367	1.1e-61	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	801	1	761	beta-glucosidase BglX.
PLN03080	PLN03080	3.49e-90	121	791	85	769	Probable beta-xylosidase; Provisional
COG1472	BglX	4.80e-71	129	480	41	377	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	2.56e-67	442	688	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	7.92e-59	65	403	2	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK60364.1	0.0	25	922	37	940
QUT92742.1	0.0	25	904	33	926
QDO69526.1	0.0	25	904	33	926
QIK54931.1	0.0	25	922	37	940
QIU94792.1	0.0	28	904	36	927

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	2.91e-133	128	798	64	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.58e-132	128	798	64	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z87_A	2.99e-127	129	805	104	785	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5TF0_A	6.91e-126	128	798	63	744	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	1.84e-123	141	794	65	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	2.23e-141	145	795	62	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	9.62e-127	133	801	89	761	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	3.09e-125	45	798	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q56078	1.14e-123	144	798	100	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
A7LXU3	3.03e-95	52	797	35	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000212	0.999166	0.000151	0.000153	0.000143	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000606_00865.